KEGG   Dechloromonas aromatica: Daro_0453Help
Entry
Daro_0453         CDS       T00259                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
dar  Dechloromonas aromatica
Pathway
dar00790  Folate biosynthesis
dar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Daro_0453
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dar04147]
    Daro_0453
Enzymes [BR:dar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Daro_0453
Exosome [BR:dar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Daro_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a DUF1610
Motif
Other DBs
NCBI-ProteinID: AAZ45210
UniProt: Q47IX1
Position
complement(496216..496554)
Genome map
AA seq 112 aa AA seqDB search
MATSCNLADRQCTPCEGGIAPLENSVAAVMLDTLPGWTLDGQRLDKTYVFRNHYEAMAFV
NAIAWVSHRENHHPELIVGYKDVRVRYWTHAIGGLSENDFICAAKLEKLLEI
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgagttgcaacctggccgatcggcaatgcacgccatgcgaaggcggcattgct
ccgctggaaaactctgtcgccgccgtcatgctggacacgctgcccggctggacactcgac
gggcagcgactggacaagacttatgtttttcgtaatcactacgaggcgatggccttcgtt
aacgccatcgcctgggtttcgcaccgggagaatcatcacccggaactgatcgtgggttac
aaggatgtccgcgtccgttactggacgcatgccatcggcggcctgtcggaaaacgacttc
atctgcgccgccaagctggagaaactgctggaaatctga

DBGET integrated database retrieval system