KEGG   Dechloromonas aromatica: Daro_0923Help
Entry
Daro_0923         CDS       T00259                                 

Definition
(GenBank) Heat shock protein Hsp70
  KO
K04043  molecular chaperone DnaK
Organism
dar  Dechloromonas aromatica
Pathway
dar03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:dar00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Daro_0923
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dar03019]
    Daro_0923
   03110 Chaperones and folding catalysts [BR:dar03110]
    Daro_0923
   03029 Mitochondrial biogenesis [BR:dar03029]
    Daro_0923
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dar04147]
    Daro_0923
Messenger RNA biogenesis [BR:dar03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     Daro_0923
Chaperones and folding catalysts [BR:dar03110]
 Heat shock proteins
  HSP70 / DNAK
   Daro_0923
Mitochondrial biogenesis [BR:dar03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    Daro_0923
  Matrix
   MMC/PAM proteins
    Daro_0923
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    Daro_0923
Exosome [BR:dar04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Daro_0923
  Exosomal proteins of breast cancer cells
   Daro_0923
  Exosomal proteins of colorectal cancer cells
   Daro_0923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA FGGY_C
Motif
Other DBs
NCBI-ProteinID: AAZ45679
UniProt: Q47HK2
Position
complement(1000169..1002106)
Genome map
AA seq 645 aa AA seqDB search
MGKIIGIDLGTTNSCVAIMEGGQPKVIENAEGARTTPSIIGYTEDGEILCGAPAKRQAVT
NPKNTLYAVKRLIGRRFEEKEVQKDISLMPFKIVKADNGDAWVEARDKKIAPPQVSAEVL
RKMKKTAEDYLGEEVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFG
MDKTSKSDRKIAVYDLGGGTFDISIIEIANVDGETQFEVLATNGDTFLGGEDFDQRLIDY
IIDEFKKESGVNLKADVLALQRLKEAAEKAKIELSSSQQTEVNLPYITADASGPKHLALK
ITRAKFESLVDELIERTMAPCVTALKDAGCKISDIDDIILVGGQSRMPKVQEKVKEIFGK
EPRKDVNPDEAVAVGAAIQGGVLQGEVKDVLLLDVTPLSLGIETLGGIMTKLIQKNTTIP
TKASQTFSTADDNQAAVTIHVLQGEREVASGNKSLGQFNLEGIPPAPRGTPQIEVIFDID
ANGIMHVTAKDKATGKENKITIKANSGLSEAEIQAMVKDAELHAEEDKKAHELADARNQA
DGMVHMVKKSLTEYGDKLDASEKAAIEAAIKDVEDVLRDGDKETITAKTEALSAAAQKLG
EKMYAQQQAEGAAAGATGQQAEAGEKTVEGDVVDAEFTEVNKDKK
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcatcggtattgacctcggcaccaccaactcctgcgtcgccatcatggaa
ggcggccagccgaaggttattgaaaacgcagaaggtgcgcgcaccacgccgtccatcatc
ggctataccgaagatggcgaaatcctgtgcggcgccccggccaagcgccaggccgtcacc
aacccgaagaacacgctgtacgctgtcaagcgcctgatcggccgccgcttcgaagagaag
gaagtacagaaggacatctccctgatgcccttcaagatcgtcaaggccgacaacggcgac
gcctgggttgaagcccgcgacaagaagatcgctccgccgcaggtttcggccgaagtgctg
cgcaagatgaagaagaccgcagaagactacctcggcgaagaagtcaccgaagccgtgatc
accgtgccggcctacttcaacgacagccagcgccaggccacgaaggacgccggccgcatc
gccggtctggaagtcaagcgcatcatcaatgagccgaccgctgctgccctcgccttcggc
atggacaagaccagcaagagcgaccgcaagatcgctgtgtatgaccttggcggcggcacc
ttcgatatctcgatcatcgaaatcgccaacgtcgacggcgaaacccaatttgaagtgctg
gccaccaacggcgacaccttcctcggcggcgaagacttcgaccagcgcctgatcgactac
atcattgacgaattcaagaaggaatccggcgtcaacttgaaggccgacgtgctggccctg
cagcgcctgaaagaagccgctgaaaaggccaagatcgagctgtcctccagccagcagacc
gaagtcaatctgccctacatcactgccgacgcctccggtccgaagcacctggccctgaag
atcacccgtgccaagttcgagtcgctggtcgacgaactgatcgagcgcaccatggcccct
tgcgtcactgcgctgaaggatgccggctgcaagatcagcgatatcgacgacatcattctg
gtcggcggccagtcgcgcatgcccaaggtgcaggagaaggttaaggaaatcttcggcaag
gaaccgcgcaaggacgtcaatccggacgaagccgttgctgtcggtgcagccatccagggc
ggcgttctgcaaggcgaagtcaaggacgtgctgctgctcgacgtcaccccgctgtcgctc
ggtatcgaaaccctgggcggcatcatgaccaagctgatccagaagaacacgacgatcccg
accaaggcctcgcagaccttctcaaccgctgacgacaatcaggcagcagtgaccattcac
gtgctgcagggcgaacgcgaagtggcttccggcaacaagagcctaggccagttcaacctg
gaaggcatcccgccggccccgcgtggcacgccgcagatcgaggtcatcttcgacatcgac
gccaacggcatcatgcacgtgacggccaaggacaaggcgaccggcaaggaaaacaagatc
accatcaaggccaactccggcttgtccgaagctgaaatccaggccatggtcaaggatgcc
gagttgcacgccgaggaagacaagaaggcgcacgaactggccgatgcccgcaaccaggcc
gacggcatggtgcacatggtcaagaagtcgctgaccgaatacggtgacaagctcgacgca
tccgaaaaggcagccatcgaagccgccatcaaggatgtcgaggacgtgctgcgcgacggc
gacaaggaaaccatcaccgccaagaccgaagccctgtcggctgccgcccagaagttgggt
gagaagatgtacgcccagcaacaggctgaaggtgcagcggccggcgccactggccaacag
gccgaggccggtgaaaagaccgttgagggtgatgtcgtcgatgccgaattcaccgaagtg
aacaaggacaagaagtaa

DBGET integrated database retrieval system