KEGG   Dechloromonas aromatica: Daro_1123Help
Entry
Daro_1123         CDS       T00259                                 

Definition
(GenBank) Phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
dar  Dechloromonas aromatica
Brite
KEGG Orthology (KO) [BR:dar00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Daro_1123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AAZ45879
UniProt: Q47H02
Position
1225078..1226085
Genome map
AA seq 335 aa AA seqDB search
MDTLNISLGVVITLVVVALLFDFMNGFHDAANSIATIVSTRVLKPHQAVIWAAAFNFLAY
FLFPLKVALTIGKGTIDPSIVDHYIIFGALIGAIVWNIVTWYYGIPSSSSHALVGGLVGA
AMAKAGIGGLVSAGVLKIIAFIFVAPFLGFVIGGFLMVIISWICRNMAPRKVDKHFRRFQ
LLSAAAYSLGHGGNDAQKTVGIIWMLLIAAGISKTTDAIPSWIVLSCYTAMGLGTMFGGW
RIVKTMGNRITKLNQARGFCANTGGAITLFLATAFGIPVSTTHTITGAIAGVGSTRGARR
VRWGVAGGIVWAWILTIPCSAAMAAAAWYLGTLIL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggacacccttaatatcagcctcggggttgtcattaccctggtcgtcgtagccttgctg
ttcgatttcatgaacggttttcacgatgcggctaattcaattgccaccattgtctcaacc
cgggttctcaagccgcaccaagccgtcatctgggcggcggcgttcaattttctcgcctat
ttcctgtttccgctcaaggtggctttgaccatcggcaaaggcaccatcgatccgtcgatt
gttgatcattacatcatcttcggtgcgctgatcggcgccattgtctggaacatcgttact
tggtattacggcattccatcgtcttcttcgcacgccctggttggcggcctggttggcgct
gccatggccaaggcaggcatcggcgggctggtctcggccggtgttctgaagatcattgcg
ttcatctttgtggccccgtttctgggcttcgtgattggcggtttcttgatggtgattatt
tcgtggatttgccgaaacatggcgccacgcaaggttgataaacacttccggcgcttccag
ttgttgtcggctgctgcctatagtcttggccacggaggcaatgatgcacaaaaaactgtt
ggcatcatctggatgttgctgatcgctgcaggtatctccaagaccactgacgcaattccg
agctggatcgtgctctcgtgctatacggcgatgggtcttggtaccatgtttggcggttgg
cgcatcgtgaaaaccatgggcaaccggatcaccaaactcaaccaggctcgtggtttctgc
gccaataccggtggtgccattaccctgtttctcgcaaccgccttcggtattcctgtttcc
accacacataccattaccggtgctattgcaggggttggttccacccgtggggctcgtcgt
gtccgctggggggtggcgggtggtatcgtttgggcatggattctgaccataccatgcagt
gctgcgatggctgctgcggcttggtacctcggcacgctcatcctctga

DBGET integrated database retrieval system