KEGG   Dechloromonas aromatica: Daro_1286Help
Entry
Daro_1286         CDS       T00259                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase precursor
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
dar  Dechloromonas aromatica
Pathway
dar00540  Lipopolysaccharide biosynthesis
dar01100  Metabolic pathways
Module
dar_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Daro_1286
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:dar01005]
    Daro_1286
Enzymes [BR:dar01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     Daro_1286
Lipopolysaccharide biosynthesis proteins [BR:dar01005]
 Unusual sugar
  Daro_1286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_4 adh_short KR DapB_N NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AAZ46038
UniProt: Q47GJ3
Position
1396799..1397797
Genome map
AA seq 332 aa AA seqDB search
MYIVVTGAAGFIGSNIVKALNERGITNIIAVDNLTKADKFKNLIDCDIVDYLDKNDFIER
IQAGHFDGEIDAILHEGACSDTMETDGRYMMENNYRYSMILLDWCLDQDVQFLYASSAAT
YGSSGTFKEERQYEGPLNVYGYSKFLFDQIVRQRLAQNPSSQIVGFRYFNVYGPRETHKG
RMASVAFHNFNQFRADGKVKLFEGSHGYPDGDQQRDFVFVGDVAKVNLFFLDHPEKSGIF
NLGSGRAQSFNDVAVAAVNGCRKARSESALSLEELRAQGLLEYVAFPEALKGKYQAFTQA
DLGKLRAAGYDAPMATVEEGVSQYIEWLQRNV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcgtcgtcaccggcgccgccggctttatcggttccaacatcgtcaaggcactt
aatgagcgtggtatcacgaacatcattgccgtcgataatctgaccaaggccgacaagttc
aagaatctgatcgattgcgacatcgtcgactatctcgacaagaacgatttcatcgagcgc
atccaggccggtcatttcgacggcgagatcgacgccatcctgcatgaaggggcttgttcc
gataccatggagacggatggccgttacatgatggagaacaactaccgttactcgatgatt
ctgctcgattggtgtctggatcaggatgtccagttcctgtatgcatcgagcgcggcgacc
tatggttccagtggcaccttcaaggaagagcgccagtacgaaggcccgctcaacgtctat
ggctattccaaatttctgtttgaccagattgttcgccagcgtctggcccagaatccgtca
tcgcaaatcgttggcttccgctatttcaacgtctacggcccgcgtgaaacgcacaaggga
aggatggcttcggtggccttccacaacttcaaccagttccgcgctgacggcaaggtgaag
ctgttcgaaggctcgcacggttacccggatggtgaccagcagcgagatttcgtcttcgtt
ggcgatgtggccaaggtcaatctgttcttcttggatcatccggaaaaatccggcattttc
aatctggggtccggccgggcgcagagcttcaatgatgtcgccgtggcggcggtcaacggc
tgccgcaaggccaggagtgaaagtgcgttgtcgctggaagagttgcgggcacaaggcttg
ctggagtatgtcgccttccccgaggcgctgaagggcaagtatcaggcattcacgcaggcc
gatctgggcaaactgcgtgcagccggttacgacgcccctatggccacggttgaggagggc
gtttcccaatatatcgagtggctccagcgcaatgtataa

DBGET integrated database retrieval system