KEGG   Dechloromonas aromatica: Daro_1584Help
Entry
Daro_1584         CDS       T00259                                 

Definition
(GenBank) Cytochrome c, class I
  KO
K08738  cytochrome c
Organism
dar  Dechloromonas aromatica
Pathway
dar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dar00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Daro_1584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Paired_CXXCH_1
Motif
Other DBs
NCBI-ProteinID: AAZ46333
UniProt: Q47FP8
Position
1702287..1702667
Genome map
AA seq 126 aa AA seqDB search
MKKQQTAFVLCLLAMLSGSQAWAAGDAKKGADVFAEECGDCHSTVAGKNKKGPSLNGVFS
RKAGSVADFSGYSDAMKQSGITWNPEKIDAYITQPKKVVAGGKMKYDGLGDAAARGDVIA
YLMSVK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaacaaactgctttcgtactttgcctgctggcgatgctttccggttcgcaa
gcctgggctgctggcgatgccaagaagggcgccgatgtctttgccgaagagtgcggggat
tgtcatagcactgtcgctggcaagaacaagaaaggccccagcttgaacggcgtcttcagc
cgcaaggccggttcggtggctgatttctccggatactccgatgcgatgaagcaaagcggc
atcacctggaatccggaaaaaatcgatgcctacatcacgcagccgaaaaaggttgtggcg
ggcggaaagatgaaatacgacggcctgggtgatgcggctgcccggggcgacgttatcgct
tacctgatgtctgtcaagtaa

DBGET integrated database retrieval system