KEGG   Dechloromonas aromatica: Daro_1885
Entry
Daro_1885         CDS       T00259                                 

Name
(GenBank) Major facilitator superfamily MFS_1
  KO
K08223  MFS transporter, FSR family, fosmidomycin resistance protein
Organism
dar  Dechloromonas aromatica
Brite
KEGG Orthology (KO) [BR:dar00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dar02000]
    Daro_1885
Transporters [BR:dar02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Fosmidomycin resistance (Fsr) family [TC:2.A.1.35]
    Daro_1885
SSDB
Motif
Pfam: MFS_1 MFS_1_like Sugar_tr OATP
Other DBs
NCBI-ProteinID: AAZ46631
UniProt: Q47EV0
Position
complement(2025249..2026457)
AA seq 402 aa
MTTATLPAPQRSDIEVISVIGFVHGVSHFFHLLLPPLFPWLMAEFGLSFTAIGTTMTVFF
IVSGIGQASAGFLVDRFGAARVLGAGISCFALAGVLLYFATGYPMLIAVAALAGLGNCVF
HPADFTVLNRHVSQQRLGHAFSAHGLSGNLGWAAAPVYITGLATAYGWRTAALGASAVAI
AALALLFWRREALTDPVEHHTEKASEPAGTTFAFLSSRAVWLCFLFFLLITAAFGTIQNF
ASPILQALYGLSITTAALALSTYLVGGAAGIVLGGFLAQKGEHDHLIAGALGVAALLAIL
LAAGIMPAWSILPLMAGIGFCTGTAGPSRDLLVRRAATARFGKAAYGRVYGFVYSGLDLG
LAMAPVIFGGLMDARHFSEVLVGIAILQFLAIFSALRVGKAV
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgacgaccgctaccctgcccgcgccccagcgcagcgacattgaagtcatttcggtgatc
ggcttcgtccatggcgtgtcccatttcttccacctcttgctgccgccactgtttccttgg
ctgatggcggagttcgggctcagtttcaccgccatcggcaccacgatgaccgtgtttttc
atcgtctccggcatcggtcaggccagtgccggttttctggttgaccgcttcggggctgcg
cgagtgctcggggccggcatcagttgctttgccctggccggcgtgctgctctatttcgcc
accggctatccaatgctgattgccgtcgccgcgttggccggcttgggtaattgcgtcttt
cacccagctgacttcacggtcctcaaccgccacgtctcgcaacaacgccttggccatgcc
ttctccgcccatgggctatccggcaatctcggctgggcggccgctccggtctatatcacc
ggcctcgccaccgcctatggctggcggacagcggcgctcggcgccagcgccgtggccatc
gccgcactggccctgctgttctggcggcgagaagcgctgaccgacccggtcgaacatcac
actgagaaggctagcgaaccggcgggaaccaccttcgccttcctgagttcgcgggctgtc
tggctgtgcttcctgttcttcctgctgatcactgcggctttcggcaccatccagaacttc
gccagcccgattttgcaggcgctctacggcttatccatcaccacagctgcactggcgctg
tcgacctatctggtcggcggtgccgccggcatcgtcctcggtggctttctcgcccagaaa
ggcgagcatgatcacctgatcgccggcgcactgggcgtggccgccctgctcgccatcctg
ctggccgctggcatcatgccggcctggagcatcctgccgctgatggccggcattggtttt
tgtaccggtaccgccgggccgtcgcgcgacctgctggtgcgccgtgccgccacagcccgc
tttggcaaggccgcctacggacgggtctatggcttcgtctattccggtctggacctcggc
ctggccatggcaccggtgatttttggcgggctgatggatgcacgacacttcagcgaagtg
ctggtcggcatcgccatcctgcaattcctcgccattttcagcgccttgcgcgttggcaag
gccgtttaa

DBGET integrated database retrieval system