KEGG   Dechloromonas aromatica: Daro_2324Help
Entry
Daro_2324         CDS       T00259                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K12061  conjugal transfer pilus assembly protein TraW
Organism
dar  Dechloromonas aromatica
Brite
KEGG Orthology (KO) [BR:dar00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dar02044]
    Daro_2324
Secretion system [BR:dar02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Daro_2324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraW_N
Motif
Other DBs
NCBI-ProteinID: AAZ47060
UniProt: Q47DM1
Position
2503885..2504520
Genome map
AA seq 211 aa AA seqDB search
MKRLIAIPLVLFALLLAAPGARAIDLGVIGPTYEISEPHLLQMIEQRLRDKERSGELKRR
EEQARERGIATVKNPPPVAGLHSTETARTYYFDPSFTLDRNILGPRGELLFAAGTRKNPL
EVVSLSRHLLFFDGRDARQVGRARQLIAFYQGRVKPILVGGSYLELMKSWRMPVYFDQQG
LLTRRFGITQVPALVSQEGLRLRIDELEIAP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcctgatcgccatcccgctcgttctcttcgcgctgctgctggccgcaccgggc
gcgcgggccattgatctgggcgtcatcgggccgacctacgagatcagcgaaccgcatctg
ctgcagatgatcgaacagcgcctgcgcgacaaggaacgcagcggcgaactcaagcgccgg
gaagaacaggcccgggaacgcggcatcgcaaccgtcaaaaacccgccaccggttgccggc
ctgcactcgaccgaaacagcccgaacctactacttcgacccgagcttcacgctagatcgc
aacatcctcggcccgcgaggcgagttgctgtttgccgccggcacccgcaagaacccgctg
gaggtggtgtcgctgtcccgacacctgctctttttcgatgggcgcgacgcgcgtcaggtc
ggccgtgcccggcagttgatcgccttctaccaggggcgggttaagccgatcctggtcggc
ggttcctacctcgaactgatgaagtcatggcgcatgccggtctatttcgatcagcagggt
ctgctcacccgtcgcttcggcatcactcaggtaccggccctggtatcgcaggaaggattg
cgcctacgcatcgacgaactggagatcgcgccatga

DBGET integrated database retrieval system