KEGG   Dechloromonas aromatica: Daro_2652
Entry
Daro_2652         CDS       T00259                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K12064  conjugal transfer pilus assembly protein TraV
Organism
dar  Dechloromonas aromatica
Brite
KEGG Orthology (KO) [BR:dar00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dar02044]
    Daro_2652
Secretion system [BR:dar02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Daro_2652
SSDB
Motif
Pfam: TraV
Other DBs
NCBI-ProteinID: AAZ47382
UniProt: Q47CP9
Position
2846678..2847259
AA seq 193 aa
MKTLILQLGAACLLLPLGACMNMSGLGGDSKYACKAPDGVACDSVSGTYANALHNNLPSQ
QAQRSARRQKETSEENASPTAGRPISLATANLSGMAITPSPLRTQARILRLWIKPWEDAD
GDLYDQGYVYVQVDNGQWQIDHVQHQIRDRYAPLKLPPKPAAETTTELGASTSSPLPMLQ
RPPLSGAGANPAQ
NT seq 582 nt   +upstreamnt  +downstreamnt
atgaagacgctgatcttgcaactcggtgccgcctgcctactgctccccttgggcgcctgc
atgaacatgtccggcctgggcggcgactcgaagtacgcctgcaaggcccccgatggcgtt
gcctgcgactcggtgtccggcacctacgccaacgcccttcacaacaatctacccagccag
caggcccaacgctccgctcgccggcagaaagagacatctgaagagaacgcctcccccacg
gctggacgtcctatttccttggcaacagccaacctttccgggatggccataacgcccagt
cccttgcgcacccaggcccgcatcctgcggctgtggatcaaaccctgggaagacgcagac
ggcgatctctacgatcagggctacgtctatgtccaggtggacaacggccagtggcagatc
gaccacgtgcaacaccagatccgtgatcgctatgcaccgctgaagctgccacccaagccg
gccgctgagacgaccaccgaactcggcgccagtacgtcgtcgcccctaccgatgttgcaa
cgcccaccgctgtccggggccggcgccaaccctgcgcagtga

DBGET integrated database retrieval system