KEGG   Dechloromonas aromatica: Daro_3022Help
Entry
Daro_3022         CDS       T00259                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dar  Dechloromonas aromatica
Pathway
dar00071  Fatty acid degradation
dar00072  Synthesis and degradation of ketone bodies
dar00280  Valine, leucine and isoleucine degradation
dar00310  Lysine degradation
dar00362  Benzoate degradation
dar00380  Tryptophan metabolism
dar00620  Pyruvate metabolism
dar00630  Glyoxylate and dicarboxylate metabolism
dar00640  Propanoate metabolism
dar00650  Butanoate metabolism
dar00900  Terpenoid backbone biosynthesis
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01120  Microbial metabolism in diverse environments
dar01130  Biosynthesis of antibiotics
dar01200  Carbon metabolism
dar01212  Fatty acid metabolism
dar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Daro_3022
   00630 Glyoxylate and dicarboxylate metabolism
    Daro_3022
   00640 Propanoate metabolism
    Daro_3022
   00650 Butanoate metabolism
    Daro_3022
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Daro_3022
   00072 Synthesis and degradation of ketone bodies
    Daro_3022
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Daro_3022
   00310 Lysine degradation
    Daro_3022
   00380 Tryptophan metabolism
    Daro_3022
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Daro_3022
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Daro_3022
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Daro_3022
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dar04147]
    Daro_3022
Enzymes [BR:dar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Daro_3022
Exosome [BR:dar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Daro_3022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAZ47752
UniProt: Q47BM9
Position
complement(3268014..3269195)
Genome map
AA seq 393 aa AA seqDB search
MSRDVVVLSAVRSAIGAFGGALADFESTELAGIVMKEAIARSGVDPQAINYVTVGTTMPT
DSRYAYVSRVASIQAGLSMDSVAMQVSRLCASGLQGIVTTAQNLMLGDADYGIGGGVEVM
SKAAYLLPALRNGARMGDTKAIDSMVAVLTDPFGVGHMGITAENLAAKHGFSREDQDAFA
VESQRRAAAAIDAGYFKSQIVPIVKQTRKGDVVFDTDEHLKRGTTMESLAKMKPAFKKDG
TVTAGNASGINDGAAFFVLAAADVAAKAGHKARARIAGYAVAGVPNDVMGEGPIPATKAA
LKKAGLTLDQMDVIESNEAFAAQALSVSKVLGLDPAKTNPNGGAIALGHPVGCSGAFIAT
KALYELERIGGKYALVTMCIGGGQGIAVIFERA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcagagatgtcgtcgttctgagcgcagttcgttccgctattggtgcttttggtggt
gccctggccgatttcgaatctaccgagctggctggtatcgtcatgaaggaagcgattgcc
cgttccggtgtcgatccccaagcaatcaactacgtaaccgtcggcaccacgatgccgacc
gattcccgctacgcctatgtttcccgcgttgcttccatccaggccggcttgtcgatggat
tccgtcgccatgcaggtttcccgcctgtgcgcttccggtctgcaaggtatcgtgacgacc
gcccagaacctgatgctgggtgatgccgactacggtatcggcggcggcgttgaagtcatg
tccaaggctgcctacttgctgccggcactgcgcaacggtgctcgcatgggtgacaccaag
gccatcgactcgatggttgccgtgctgaccgatccgtttggcgttggtcacatgggtatt
actgctgaaaacctcgctgccaagcatggcttcagccgtgaagaccaggatgccttcgct
gtcgaatcgcagcgtcgcgctgctgccgccattgatgccggctacttcaagtcgcagatc
gtgccgatcgtcaagcagacccgcaagggcgacgtggtgttcgacaccgacgagcacctg
aagcgtggcacgaccatggaatccctggccaagatgaagccggccttcaagaaggacggt
accgttaccgccggtaacgcttccggcatcaacgacggcgctgctttcttcgtgctggct
gccgctgatgtggctgccaaggctggtcacaaggctcgtgcccgtatcgctggctatgcc
gttgccggcgtgccgaacgatgtcatgggcgaaggcccgatcccggcgaccaaggctgcc
ctgaagaaggctggcctgaccctggatcaaatggatgtcatcgagtccaacgaagccttc
gctgcccaggcactgtcggtttccaaggtgctcggccttgatccggccaagaccaacccg
aacggcggcgcgatcgccctcggtcacccggttggctgttccggtgccttcatcgccacc
aaggcgctgtatgaactggaacgcattggcggcaagtacgcactggtcaccatgtgtatc
ggtggcggccaaggtattgcggtcatcttcgaacgcgcctaa

DBGET integrated database retrieval system