KEGG   Dechloromonas aromatica: Daro_3299Help
Entry
Daro_3299         CDS       T00259                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dar  Dechloromonas aromatica
Pathway
dar00010  Glycolysis / Gluconeogenesis
dar00030  Pentose phosphate pathway
dar00051  Fructose and mannose metabolism
dar00052  Galactose metabolism
dar00230  Purine metabolism
dar00500  Starch and sucrose metabolism
dar00520  Amino sugar and nucleotide sugar metabolism
dar00521  Streptomycin biosynthesis
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01120  Microbial metabolism in diverse environments
dar01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daro_3299
   00030 Pentose phosphate pathway
    Daro_3299
   00051 Fructose and mannose metabolism
    Daro_3299
   00052 Galactose metabolism
    Daro_3299
   00500 Starch and sucrose metabolism
    Daro_3299
   00520 Amino sugar and nucleotide sugar metabolism
    Daro_3299
  Nucleotide metabolism
   00230 Purine metabolism
    Daro_3299
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Daro_3299
Enzymes [BR:dar01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Daro_3299
    5.4.2.8  phosphomannomutase
     Daro_3299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AAZ48029
UniProt: Q47AV2
Position
3547851..3549227
Genome map
AA seq 458 aa AA seqDB search
MRQLPAEIFKAYDIRGIVNKTLTADVVRQIGHALGSLAAEQGQKAIAVGRDGRLSGPELA
CALMEGICAAGVDAIDVGCVPTPVTYFAAYELGCNSCVSVTGSHNPPDYNGLKMVIGGTT
LALDAIQDLKKRAETGNLKHGKGERRSANVLPAYVERIVGDVKLARPMKIVMDCGNGVAG
VIAPELFKRLGCEIVPLFCEVDGNFPNHHPDPSKPENLADVIKALKETDAEIGIAFDGDG
DRLGVVTKDGEIIFPDRQLMLFAADVLSRVPGGQIIYDVKCTRLLAPWIKQHGGVPLMWN
TGHALVKAKLKETGAPLAGEMSGHTFFKERWYGFDDGLYTGARLLEILSRAADANPILKN
LPNAPSTPELNIKMAEGEPFALIDKLKTEGKFDGAEEIITIDGVRVEYSDGFGLARPSNT
TPVVVLRFEADNAAALERIQRAFRQSLNAIWPGIQLPF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaactccccgctgagatattcaaggcctacgacattcgtggcatcgtcaacaag
accctgaccgccgatgtcgtccgccagattggtcatgcactcggctctctggctgccgag
cagggccagaaggcgatcgccgtcggtcgtgatggccgcctgtccggccccgaactggcc
tgtgcgctgatggagggaatatgcgccgccggcgttgacgccatcgacgtgggctgcgta
ccaaccccggtcacctacttcgccgcctacgaacttggctgcaactcctgcgtttcggtc
accggcagccataatccgccggactacaacggcctgaaaatggtgatcggcggcaccaca
ctggccctcgatgcgatacaggacctgaaaaaacgtgccgaaaccggcaatctgaagcac
ggcaagggcgaacgtcgtagcgccaacgtgctgccggcctatgttgaaagaatcgtcggc
gacgtcaagctggcccgcccgatgaagatcgtcatggattgcggcaacggtgtggccggc
gtgatcgccccggaactgttcaagcgcctcggctgcgaaatcgtcccgctgttctgtgaa
gtagacggcaatttcccgaatcaccatcctgatccgtcgaagccggaaaacctggccgat
gtgatcaaggcactcaaggaaaccgatgccgagatcggcatcgccttcgacggcgacggc
gatcgactgggcgtcgtcaccaaggatggcgagatcatcttcccggaccgccagctgatg
ctcttcgcggccgacgtgctgtcccgtgtaccgggcggccagatcatctacgacgtcaaa
tgtactcgcctactggcaccgtggatcaaacaacatggcggcgtgccgctgatgtggaac
accggccacgcactggtcaaggccaagttgaaggaaaccggcgccccgctggctggcgaa
atgtccggtcacaccttcttcaaggaacgttggtacggcttcgatgacggcctgtacacc
ggtgcccgcctgctggaaatcctgagccgggcggccgatgccaacccgatcctgaaaaat
ctgcccaatgccccgtcaaccccggaactgaacatcaagatggccgaaggcgaacccttc
gcgctgatcgacaagctgaaaaccgagggcaagtttgacggcgccgaggaaatcatcacg
attgacggtgtgcgggtggaatattctgacggcttcgggctagcccgcccgtcgaacacc
acgccagtcgtcgtgctgcgtttcgaagccgacaacgctgccgccctggaacgcatccag
cgcgctttccgtcagtcgctcaacgccatctggccaggcatccagttacccttctaa

DBGET integrated database retrieval system