KEGG   Dechloromonas aromatica: Daro_3473Help
Entry
Daro_3473         CDS       T00259                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
dar  Dechloromonas aromatica
Pathway
dar00330  Arginine and proline metabolism
dar00332  Carbapenem biosynthesis
dar01100  Metabolic pathways
dar01130  Biosynthesis of antibiotics
dar01230  Biosynthesis of amino acids
Module
dar_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Daro_3473
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Daro_3473
Enzymes [BR:dar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Daro_3473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AAZ48202
UniProt: Q47AC9
Position
3721011..3722129
Genome map
AA seq 372 aa AA seqDB search
MNPTRLANAKRLVVKVGSALVTNNGTGLDLSAINDWARQIAVLRQQDKEVVLVSSGAIAC
GMQRLGWAKRPKSVHELQAAAAVGQMGLVQVYEGAFAKHGLHTAQILLTHDDLADRKRYL
NARSTLNTLLELGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEADALIILTDQQGLY
TADPRKDPSATLINEATAGDETLEGMAGGAGTRIGTGGMITKVIAAKRAARSGAHTAIAS
GRETDPIIRLANGEPVGTLLVSQTQPLAARKQWLADHLQLAGRLILDAGAVNALHAGKSL
LPIGVIAAEGEFERGAAVACISPDGREIARGLSNYGSGEARLIARKTTQEIENTLGYVDE
PEIIHRDNLILS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccacccgcctcgccaacgccaagcgcctggtcgtcaaagtcggctcggcgctc
gtcaccaacaacggcaccggccttgacctctcagccatcaacgactgggcgcgacagatc
gccgtcctgcgccagcaagacaaggaagtcgtactcgtctcctccggcgccatcgcctgc
ggcatgcagcgcctgggctgggccaaacgaccgaagagcgtgcacgaactccaggcggcc
gctgccgttggccagatgggcctcgtccaggtctatgaaggcgccttcgccaagcacggc
ctgcataccgcccagatcctgctgacccacgacgaccttgccgatcgcaagcgctacctg
aacgcccgctcgaccctaaataccctgctcgaactcggcgtcgtccccatcatcaacgag
aacgacaccgtcgtcaccgacgagatcaagttcggcgacaacgacaccctcggcgcactg
gtcgccaatctgatcgaagccgatgcgctgatcatcctgaccgaccagcaaggtctgtac
acggccgatccgcgcaaggacccgagcgccacactgatcaacgaagccacggccggcgac
gaaacactggaaggcatggccggcggcgccggcacccgcatcggcactggcggcatgatc
accaaggtcattgccgccaaacgcgccgcacgcagcggcgcccataccgccatcgccagc
ggccgcgaaaccgacccgatcatccgcctggccaatggcgaaccggtcggcaccctactc
gtctcgcaaacccaaccgctggctgcccgcaagcaatggcttgctgaccacctgcaactg
gctggccgcctgatcctcgatgccggcgccgtgaatgcgctacatgccggcaagagcctg
ctcccgatcggcgttatcgccgccgagggagaattcgaacgcggcgctgccgttgcctgc
atcagccccgacggccgagaaatcgcccgcggcctgagcaactacggcagcggcgaagcc
cggctgatcgcccgcaagaccacccaggaaatcgagaatacactgggctacgtggacgaa
ccggaaatcatccaccgggacaacctgatcctctcctga

DBGET integrated database retrieval system