KEGG   Dechloromonas aromatica: Daro_3474Help
Entry
Daro_3474         CDS       T00259                                 

Definition
(GenBank) Porin, Gram-negative type
Organism
dar  Dechloromonas aromatica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porin_4 Porin_1
Motif
Other DBs
NCBI-ProteinID: AAZ48203
UniProt: Q47AC8
Position
complement(3722263..3723417)
Genome map
AA seq 384 aa AA seqDB search
MQKKIIALAIAGLASTAAFAQSNVTIYGVADATFDSVKATKGSSASEQAAFVTRQRVTAN
SSYIGFKGVEDLGNGLKAVFQFENGINNDNSSAGSWNNRDSYVGLSGGFGTVVAGNLTGP
TRAVGAKYDVNQGATGIGANAALLGKLGTIAGDSGASAFDQRISNAVAYVSPTVAGFTGV
IGYSTGLSSAAIAGTAAAVIGTNREATGAGDVQFNTARTLGLGYANGPISVDYAYTRVGL
KDAQNDLQDHRLGFLFSQGWGSVGLLAERTSLQATTGNLTQNVFYVPVKVNVGKGRVIGQ
FGHAGNVKNTVASEGANHYVLGYEHDLSKRTTLKLVYSQINNKEGSNYDYLYGAGNANST
ATNTSGVANDANVKGISLGLRHAF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagaagattatcgctttggccatcgctggtctggcttctaccgctgctttcgct
caatccaacgtcaccatctacggtgttgctgatgccaccttcgacagcgtcaaggctacc
aagggctcttccgcctctgagcaagctgctttcgttactcgtcagcgcgttactgccaac
tcttcctacatcggcttcaagggtgttgaagatctgggcaacggcctgaaggctgtcttc
cagttcgaaaatggtattaacaacgacaacagcagcgctggttcttggaacaaccgtgac
tcctacgttggtctgtctggtggtttcggtaccgttgttgctggtaacctgactggcccg
acccgtgcagttggcgccaagtacgacgtcaatcaaggtgcaaccggtatcggcgctaac
gccgctctgctcggcaagctgggtaccatcgcaggtgattccggcgcttccgcattcgat
cagcgtatctccaacgctgttgcctacgtctccccgaccgttgctggtttcacgggcgtg
atcggttactccaccggtctgtccagcgccgctatcgctggtactgccgctgccgtgatt
ggtacgaaccgcgaagctaccggtgcaggtgatgttcagttcaacaccgctcgcactctg
ggtctcggctacgcaaatggcccgatctcggttgattacgcctacacccgtgttggtctg
aaggatgctcaaaatgacctccaagaccatcgtctgggcttcctgtttagccaaggttgg
ggttctgtcggtctgctggccgagcgtacctccctccaggctaccactggcaacctgacc
cagaacgtgttctatgttccggttaaggttaatgttggcaagggccgtgtcattggtcaa
tttggccacgctggtaacgtgaagaacactgttgcttccgaaggtgctaaccactacgtt
ctgggttacgagcacgatctgtccaagcgtaccaccctgaagttggtctattcccagatc
aacaacaaggaaggttcgaactacgactacctgtatggcgctggcaatgctaacagcacg
gctaccaacacctctggtgttgctaacgatgcaaacgtcaagggtatttccctgggcctg
cgtcacgctttctaa

DBGET integrated database retrieval system