KEGG   Dechloromonas aromatica: Daro_3475Help
Entry
Daro_3475         CDS       T00259                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dar  Dechloromonas aromatica
Pathway
dar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01130  Biosynthesis of antibiotics
dar01230  Biosynthesis of amino acids
Module
dar_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daro_3475
Enzymes [BR:dar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Daro_3475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AAZ48204
UniProt: Q47AC7
Position
complement(3723591..3724379)
Genome map
AA seq 262 aa AA seqDB search
MSDILNKIIATKREEVAAARLAKPLAIVEAEAIAQPAPRDFVGAIRNKIANDRPAVIAEI
KKASPSKGIIRPDFQPADIARSYEQHGAACLSVLTDRQYFQGCPEYLQSARAACALPVLR
KDFMVDAYQVAEARAMGADAILLIAAALTLEEMQALETQASAYGMAVLVEVHNGEELDAA
LQLKTPLLGINNRNLRTFAVTLETTLGLLSRIPAGRIVVTESGILKPEEVALMRTNKVNA
FLVGEAFMRVPEPGAELARLFA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcaacaagatcatcgccaccaagcgcgaagaagttgctgcggcaagg
ctcgccaaacccttggctatcgttgaggccgaagcgatagcccagccagcgcccagggat
tttgtcggcgccattcgcaacaagatcgccaatgatcggccggccgtgattgctgaaatc
aagaaagccagcccatcgaagggcatcatccgccccgattttcagcccgcggatatcgcc
cgcagctacgagcagcatggtgcggcctgtctgtcggtgctgacggatcgccagtatttc
cagggttgccctgaatatctccagtctgcccgtgccgcctgtgcgctgccggtgctgcgc
aaggacttcatggttgatgcctatcaggtggccgaagcgcgagccatgggggctgacgcc
atcctgttgatcgctgcggcactgacgctggaagaaatgcaggcccttgaaacacaggcc
agcgcttacggcatggccgtgctggtcgaagtgcacaacggcgaagagctcgatgccgcc
ttgcaactcaaaactccgctgctcggcatcaacaaccgtaacctgcgcacctttgccgtg
acgcttgaaacaacgctcggtttgctgtccaggattccggctggccgcatcgtggtcact
gaaagcggcatcctgaagccggaagaagtcgccctgatgcgcaccaacaaggtcaatgcc
ttcctggtcggcgaagccttcatgcgcgtgcccgagccaggtgccgagttggcccgattg
ttcgcctga

DBGET integrated database retrieval system