KEGG   Dechloromonas aromatica: Daro_3476Help
Entry
Daro_3476         CDS       T00259                                 

Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
dar  Dechloromonas aromatica
Pathway
dar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01130  Biosynthesis of antibiotics
dar01230  Biosynthesis of amino acids
Module
dar_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daro_3476
Enzymes [BR:dar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     Daro_3476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AAZ48205
UniProt: Q47AC6
Position
complement(3724376..3725398)
Genome map
AA seq 340 aa AA seqDB search
MTPQAALQRVIEHREIFHDEMVSLMRQIMSGEVTPVMIAAIITGLRVKKETIGEIAAAAS
VMRELATPVKVPYDRHFVDIVGTGGDAAHTFNISSTAAFVVAAAGGKVAKHGGRSVSSSS
GAADVLEALGANIMLSPEQVAACIDETGFGFMFAPNHHTAMKHVAPVRREMGVRTIFNIL
GPLTNPAGAPNTLMGVFHPDLVGILVRVMQRLGAERVLVVHGKDCLDEISLGAATMVGEL
NNGEIREYEIHPEDYGLQMQSLRNLRVGSAAESREMLLGVLGNQPGPAREIVCLNAGAAL
YVANVADSIGDGIVRAREAIASGAARAKLDQFINATKKFA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgcaagccgcactgcagcgtgtcatcgaacaccgcgaaatcttccatgacgaa
atggtctccctgatgcgccagatcatgagcggcgaagtcacgccggtcatgatcgctgcc
atcatcaccgggctgcgcgtcaagaaggaaaccattggcgaaatcgctgctgccgcaagc
gtcatgcgcgaactggcgacgccggtcaaggtgccttacgacaggcatttcgtcgacatc
gtcggtaccggtggtgatgcggcgcacaccttcaatatctcctcgactgcagccttcgtc
gtcgctgccgccggtggcaaggtcgccaagcacggagggcgcagcgtgtcctccagttcc
ggtgcagccgacgtgctggaggcgctgggcgccaatatcatgctgtcacccgagcaggtt
gccgcctgtatcgatgaaaccggcttcggcttcatgttcgccccgaatcaccacaccgcc
atgaagcacgtcgccccggtgcgccgcgagatgggggtgcgcaccatcttcaatatcctt
ggtccgctaaccaatccggccggcgcgccgaatacgctgatgggcgtgttccatcccgat
ctcgtcggcatcctggtgcgcgtcatgcaacgcctcggtgccgagcgcgtgctggtggtg
cacggcaaggattgtctggacgaaatctccctcggcgccgccacgatggtcggcgaattg
aataacggtgaaatccgcgaatatgagattcaccctgaagactacggtttgcagatgcag
tcgttgcgcaatctgcgcgtcggtagtgccgcagagtcccgggaaatgctgctcggcgtg
ctcggcaaccagccaggcccggcacgcgaaatcgtctgtctcaacgccggtgccgcgctc
tatgtcgccaatgtggccgacagcattggtgacggcattgtcagggcccgtgaggccatt
gccagcggcgcggcgcgggccaagcttgatcaattcatcaatgccacgaagaaattcgca
tga

DBGET integrated database retrieval system