KEGG   Dechloromonas aromatica: Daro_3477Help
Entry
Daro_3477         CDS       T00259                                 

Definition
(GenBank) anthranilate synthase, component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
dar  Dechloromonas aromatica
Pathway
dar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01130  Biosynthesis of antibiotics
dar01230  Biosynthesis of amino acids
dar02024  Quorum sensing
Module
dar_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daro_3477
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Daro_3477
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Daro_3477
Enzymes [BR:dar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Daro_3477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AAZ48206
UniProt: Q47AC5
Position
complement(3725395..3725967)
Genome map
AA seq 190 aa AA seqDB search
MLLMIDNYDSFTYNLVQYFGELGQDVKVFRNDAISLSEIAQMKPDYLVISPGPCAPAQAG
VSLAAIKEFAGKIPLLGVCLGHQSIGEAFGGKIVHAKQLMHGKVSPVHHKDIGVFRGLPN
PLTCTRYHSLAIERATLPDCLEITAWTDDGEIMGVRHKTLAVEGVQFHPESILTECGHDL
LKNFLEEHKQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgatgatcgataactacgacagctttacctataacctcgtccagtacttcggt
gagctggggcaggacgtcaaggtctttcgcaacgacgcaatctcgctgtccgagatcgcg
cagatgaaacccgactatctggtcatttcccccggcccttgtgcgccggcccaggccggt
gtttcgctggcagcgatcaaggagttcgccggcaagatcccgctactcggcgtctgtctg
ggccaccagtcgatcggcgaagcctttggcggcaagatcgtgcacgccaagcagttgatg
catggcaaggtatcgccggttcatcacaaggatatcggcgtcttcaggggtttgcccaac
ccgctgacctgcacccgctaccactcgctggccatcgaacgcgccacgttgccagattgc
ctcgaaatcaccgcctggaccgacgatggcgaaattatgggcgtccgccacaagacgctg
gctgtcgaaggcgtgcaatttcatccggaatcgatcctgaccgagtgcggtcacgatctg
ttgaagaacttcctcgaggaacacaagcaatga

DBGET integrated database retrieval system