KEGG   Dechloromonas aromatica: Daro_3478Help
Entry
Daro_3478         CDS       T00259                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dar  Dechloromonas aromatica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT_2
Motif
Other DBs
NCBI-ProteinID: AAZ48207
UniProt: Q47AC4
Position
3726071..3727591
Genome map
AA seq 506 aa AA seqDB search
MFETSCPPATSTLLAPKKMGMSLPTRPPGQIGTLLALFIAVLAWRAIAFSLSNATLYVDE
AQYWFWSQHLAWGYFSKPPGIAALIHLSTALFGDGPLGVKALTMLCYPLSALICWLIAQH
LYDASTAFWAAIAALTLPIYSWLGLFASTDAPLTLLWLLGLWFYLRAIEHGRWMDWLMLG
AACGLGLLSKYTMAVFIAALFLHLLCFHRTFLTSAKPWAAAGLSLALLAPNLLWNLANDF
PTLRHTADITLNRHNGGGLKSLAEFWAAQWISFGPLLGSVVALILFRFRETWRDTPARLL
LWFSLPLWAVVSVQALQGSANANWAAPAFGPMAILLVAWLRQRDQHKWLLTGVATNFALI
GVIYHAPGLLAAANVSSQAKLNPFIRATGWDELGQQLRPLVQTHPNAVLIANNRTLLAHM
AYELHGQQPRIASWNPEGVASDHFKLTMKLDAHRGGDALLLTEAAPDQEFTERFTHVEKL
ASLAAPLDTINSRHIEVYLLHEFQGY
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagacttcatgccccccagccaccagcactttgctcgctcctaaaaaaatgggc
atgagcttaccaaccaggccaccaggccagatcggcacgctgctggccctgttcatcgcc
gtccttgcctggcgggcgattgccttttcgttatcgaacgcgaccttgtatgtggacgaa
gcgcaatactggttctggtcgcaacatctggcgtggggctatttttccaagccaccgggc
atcgccgccctgattcatctgtcgacggcactgtttggcgatggcccgctcggcgtcaag
gcgctgaccatgctgtgctatccgttgagtgcgctgatctgttggctgatcgcccagcac
ctctacgacgcctcgactgctttctgggctgccatcgccgcactcacgctgcccatctat
tcctggcttggcctgttcgcttcgactgatgcgccattgacgttactctggctgctcggc
ctgtggttttatctgcgcgccattgaacatggacgctggatggattggctgatgcttggc
gcggcctgcggattgggattgctgtcgaaatacacgatggcagtattcatcgctgcgctc
ttcctgcacctgctctgctttcaccgcactttcctgaccagcgccaagccctgggcggct
gccggactgagcctggcattgcttgcgcccaacctgctctggaaccttgccaacgatttc
ccaacacttcgccataccgccgatatcacgctgaatcgccacaacggcggtggcttgaaa
tcgctggcggagttctgggcggcccaatggatcagcttcggaccgctactcggcagtgtc
gtcgcactgatcctgttccgttttcgcgagacctggcgcgacacaccagcccgcctgctg
ctctggttctcgctgccgctgtgggccgtcgtctcggtgcaggcgcttcaaggcagcgcc
aacgccaactgggcggcacccgcattcgggccgatggccatcctgctggtcgcctggtta
cgccagcgcgaccagcacaaatggctattgaccggggtcgccaccaacttcgccctcatc
ggcgtgatctaccacgcccccggcctgctggcagccgccaatgtaagcagccaggcgaaa
ctgaacccgtttattcgtgcaactggctgggatgagctcggacagcagcttcgccccctc
gtacagacccaccccaatgccgtgctgatcgcgaacaaccgcacgctgctcgcgcacatg
gcttacgaactgcatggccagcagccgcgcattgccagctggaacccggaaggcgtggcc
agcgaccacttcaaattgacgatgaagctcgacgctcaccgtggcggcgatgcgctgttg
ctgaccgaggctgcaccagaccaggaattcaccgaaaggttcacgcacgtcgaaaagctg
gcctcgctggcagcgccactcgacacaatcaattcacgccatatcgaggtttatttactc
catgaattccagggatattga

DBGET integrated database retrieval system