KEGG   Dechloromonas aromatica: Daro_3479Help
Entry
Daro_3479         CDS       T00259                                 

Definition
(GenBank) Phosphoesterase, PA-phosphatase related protein
  KO
K12978  lipid A 4'-phosphatase [EC:3.1.3.-]
Organism
dar  Dechloromonas aromatica
Brite
KEGG Orthology (KO) [BR:dar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:dar01005]
    Daro_3479
Enzymes [BR:dar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     Daro_3479
Lipopolysaccharide biosynthesis proteins [BR:dar01005]
 Lipid A
  Daro_3479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAP2 PAP2_3 PAP2_C COX7a
Motif
Other DBs
NCBI-ProteinID: AAZ48208
UniProt: Q47AC3
Position
3727572..3728339
Genome map
AA seq 255 aa AA seqDB search
MNSRDIEFRLAVIIASALAVLFVAFPETDLWVSRLFQQNNWQWLLTPNSPLISIPYHGLP
NLGRALIVGLLLCWLGSFIYRHPMLKSRRFFFGFLLAAALIGPVLVVDAGLKNHVGRARP
AQIEAFGGGMLFTPAFTPSNQCERNCSFVSGHVATTAFVMAFGWLSSASIRRRWLLGSIA
AAALMGLVRMSTGGHFLSDCLFGWFATYFCLCLTEWAFLQLSWHREAIRSWRRFPPLGAW
LPLPTRNPGAQWAGH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaattccagggatattgaattccgactggcggtgatcatcgccagcgcattggccgtg
ctgttcgttgcctttccggaaacggatctatgggtctcccgcctattccaacagaacaac
tggcagtggctgctgactccgaacagcccattgatcagcatcccgtaccacggactcccc
aacctggggcgagcactgattgtcggcttgctgctgtgctggctgggcagcttcatctac
cggcacccgatgttgaaatcgcggcgtttcttttttggcttcctgctggcagccgcattg
attggccccgttctggtcgtcgatgccggcctgaaaaaccacgtcggacgcgcccgcccg
gcgcaaatcgaggctttcggcggaggcatgctcttcacgccggccttcaccccgagcaat
cagtgcgagcgcaattgctcattcgtcagcggacacgtcgccacaacggcctttgtcatg
gcgttcgggtggctgagcagcgcgtccattcgccgtcgctggctgctcggcagcattgcg
gcagccgccttgatggggctggtgcgcatgtcgacgggtgggcacttcctgtccgattgc
ctgttcggctggttcgccacctacttttgcctatgcctgaccgaatgggcttttttgcag
ctctcgtggcatcgcgaagcgattcgatcctggcgacgcttccctccgctgggcgcatgg
cttccgcttccaacaaggaaccccggcgcccaatgggcaggccactga

DBGET integrated database retrieval system