KEGG   Dechloromonas aromatica: Daro_3479Help
Entry
Daro_3479         CDS       T00259                                 

Definition
(GenBank) Phosphoesterase, PA-phosphatase related protein
Organism
dar  Dechloromonas aromatica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAP2 PAP2_3 PAP2_C COX7a
Motif
Other DBs
NCBI-ProteinID: AAZ48208
UniProt: Q47AC3
Position
3727572..3728339
Genome map
AA seq 255 aa AA seqDB search
MNSRDIEFRLAVIIASALAVLFVAFPETDLWVSRLFQQNNWQWLLTPNSPLISIPYHGLP
NLGRALIVGLLLCWLGSFIYRHPMLKSRRFFFGFLLAAALIGPVLVVDAGLKNHVGRARP
AQIEAFGGGMLFTPAFTPSNQCERNCSFVSGHVATTAFVMAFGWLSSASIRRRWLLGSIA
AAALMGLVRMSTGGHFLSDCLFGWFATYFCLCLTEWAFLQLSWHREAIRSWRRFPPLGAW
LPLPTRNPGAQWAGH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaattccagggatattgaattccgactggcggtgatcatcgccagcgcattggccgtg
ctgttcgttgcctttccggaaacggatctatgggtctcccgcctattccaacagaacaac
tggcagtggctgctgactccgaacagcccattgatcagcatcccgtaccacggactcccc
aacctggggcgagcactgattgtcggcttgctgctgtgctggctgggcagcttcatctac
cggcacccgatgttgaaatcgcggcgtttcttttttggcttcctgctggcagccgcattg
attggccccgttctggtcgtcgatgccggcctgaaaaaccacgtcggacgcgcccgcccg
gcgcaaatcgaggctttcggcggaggcatgctcttcacgccggccttcaccccgagcaat
cagtgcgagcgcaattgctcattcgtcagcggacacgtcgccacaacggcctttgtcatg
gcgttcgggtggctgagcagcgcgtccattcgccgtcgctggctgctcggcagcattgcg
gcagccgccttgatggggctggtgcgcatgtcgacgggtgggcacttcctgtccgattgc
ctgttcggctggttcgccacctacttttgcctatgcctgaccgaatgggcttttttgcag
ctctcgtggcatcgcgaagcgattcgatcctggcgacgcttccctccgctgggcgcatgg
cttccgcttccaacaaggaaccccggcgcccaatgggcaggccactga

DBGET integrated database retrieval system