KEGG   Dechloromonas aromatica: Daro_3481Help
Entry
Daro_3481         CDS       T00259                                 

Definition
(GenBank) anthranilate synthase, component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
dar  Dechloromonas aromatica
Pathway
dar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01130  Biosynthesis of antibiotics
dar01230  Biosynthesis of amino acids
dar02024  Quorum sensing
Module
dar_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daro_3481
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Daro_3481
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Daro_3481
Enzymes [BR:dar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Daro_3481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AAZ48210
UniProt: Q47AC1
Position
complement(3729507..3730982)
Genome map
AA seq 491 aa AA seqDB search
MTETEFNSLAAQGYNRIPVTLETFADLDTPLSIYLKLANAPYTYLLESVQGGERFGRYSI
IGLAAQTRIVVNGHQVLVLTGNRIAERENDTNPLEFIGKFMQRFRAPPANGLPRFCGGLV
GCFGYDTVRYVETRLTRTNKPDEIGTPDIGLLLSEEIAVVDNLSGKLTLIVYAEPGFPGA
YQKARARLKELLQKLRTPVSLPSEQPVHSEAAVSVFGEAAFKQAVLKAKAYITEGDIMQV
VLSQRMTKPFLASPLALYRTLRSLNPSPYMFYFDFEDFHVVGASPEILVRLEGERVTVRP
IAGTRKRGASPEEDAALAVELLADEKERAEHTQLLDLGRNDCGRVARVGSVKLTENMIVE
RYSHVMHIVSNVEGKLQPGLDALDVLRATFPAGTVSGAPKVRAMEIIDELEPVKRGIYAG
SVGYLGFNGDMDVAIAIRTAVLKDKKLYVQAGAGIVADSDPNSEWTETLNKARAVLRAAE
LAEQGLDTRID
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaccgaattcaattcgcttgccgcgcaaggctacaaccgtattcccgtcacg
ctggaaacgtttgccgatctcgacacgccgctctccatctacctgaagctggccaatgcg
ccctacacctacttgctcgaatcggtgcagggcggtgagcgcttcggtcgctactcgatc
atcggtctggctgcccagacgcgtatcgtcgtcaatggccaccaggtgctggtgctgacc
ggcaaccgtatcgccgagcgtgaaaacgacaccaacccgctggaattcatcggcaagttc
atgcagcgcttccgggcgccgccggcgaacggcctgccacgcttctgcggcggcctggtc
ggttgcttcggctacgacaccgtgcgttacgtcgaaacccgcctgacccgcaccaacaag
ccggacgaaatcggcacgccggacatcggcctattgctttccgaagaaatcgctgtcgtc
gacaacctgtccggcaagctgacgctgatcgtctatgccgagcccggcttccccggtgcc
tatcagaaggcccgcgcccgtctcaaggaattgctgcagaaactgcgcacgccggtctcc
ctgcccagcgagcagccggtccattcggaagcggccgtttccgtctttggcgaagcggcc
ttcaagcaggctgtgctcaaggccaaggcctacatcaccgaaggtgacatcatgcaggtc
gtgctgtcgcagcgcatgaccaagcccttcctggcgagccctctggcgctctatcgcacc
ctgcgcagcctgaatccgtcgccctacatgttctacttcgacttcgaggatttccacgtg
gtcggcgcctcgccggagattctggttcgcctcgaaggcgagcgcgtcacggttcggccg
attgccggcacccgcaagcgcggtgcttcgccggaagaggatgcagctctggccgtcgaa
ctgctggccgatgaaaaagaacgggccgaacatacccagttgctcgacctcggccgcaac
gactgcgggcgtgtcgcgcgtgtcggttcggtcaagctgaccgaaaacatgatcgtcgag
cgttattcgcacgtgatgcatatcgtttccaatgtcgagggcaagctgcagccgggtctg
gatgcacttgacgtgctgcgcgccaccttcccggccggcaccgtctccggtgcgcccaag
gtgcgggcgatggaaatcatcgacgaactggaaccggtcaagcgtggcatctacgccggt
tcggtcggctatctcggtttcaacggcgacatggatgtggccattgccatccgcacggct
gtgctcaaggacaagaagctctatgtgcaggccggtgccgggatcgtcgccgattccgat
ccgaattcggaatggaccgaaaccctgaacaaggcgcgtgccgtgctgcgtgcggccgaa
ctggccgagcagggtctggatacaaggatcgactga

DBGET integrated database retrieval system