KEGG   Dechloromonas aromatica: Daro_3487Help
Entry
Daro_3487         CDS       T00259                                 

Definition
(GenBank) glutamate N-acetyltransferase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
dar  Dechloromonas aromatica
Pathway
dar00220  Arginine biosynthesis
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01130  Biosynthesis of antibiotics
dar01210  2-Oxocarboxylic acid metabolism
dar01230  Biosynthesis of amino acids
Module
dar_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Daro_3487
Enzymes [BR:dar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     Daro_3487
    2.3.1.35  glutamate N-acetyltransferase
     Daro_3487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: AAZ48216
UniProt: Q47AB5
Position
complement(3734590..3735816)
Genome map
AA seq 408 aa AA seqDB search
MPVNYATPAADQLFPVAGVRLGVAEAEIRKKNRRDLTLVALDAGCTVAGVFTQNRFCAAP
VQLCRNHLAGGHEIRALVINTGIANAGTGEPGRQTAQASCDAVAELLGIKAEQVLPFSTG
VILEPLPVERLKAGLPAAKADLKADNWHAAAHAIMTTDTVAKAASRVVTVNGKKISISGV
SKGAGMIKPNMATMLGFLATDASIAQGMLDKLVKEAADASFNCITVDGDTSTNDSFVMIA
SGQSGASFATETDAGWAEVKAAIIAVSVELAQAIVRDGEGATKFITVAVEGGKDSEECRK
VGYAIGHSPLVKTAFFASDPNLGRILAAVGYAGINDLDVDGVRVWLDEVLVAEKGGRAAA
YKEEDGARVMAQAEITVRVDLGRGAAKASVYTCDFSYDYVKINADYRS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcaattacgctacccccgctgctgaccaactgtttccggtggcgggcgtccgc
ctcggtgttgccgaagccgaaattcgcaaaaagaaccgccgcgatctgactctggtggcg
ctcgacgccggttgcacggtggccggcgtgtttacccagaaccgtttctgcgctgcaccg
gtgcagctctgtcgcaaccatctggccggcggccatgaaatccgcgcactggtcatcaat
accggcatcgccaatgccggcaccggcgaaccaggccgccagacggcgcaggcgagttgc
gacgcggtggctgaactgctgggcatcaaggcggagcaggtgctgccgttctctacgggc
gtcattcttgaacccttgccggtcgagcgcctgaaagccggtctgccggctgccaaagcc
gacctcaaggcggataactggcacgccgccgcccatgccatcatgaccactgatactgtc
gccaaggcggcttcgcgtgtggtcacggtcaacggcaaaaaaatcagcatttccggggtg
tccaaaggcgctggcatgatcaagccgaacatggcgaccatgctcggtttcctggccacc
gatgccagcattgcccagggcatgctcgacaagctggtcaaggaagcggccgatgcctcg
ttcaactgcatcaccgtcgatggtgacacctcgaccaacgactccttcgtaatgattgcc
agcggccagtcgggcgccagctttgccacggaaaccgatgccggctgggccgaggtcaag
gctgcgatcatcgctgtctcggtcgaactggcccaggccatcgttcgtgatggcgaaggt
gcgaccaagttcatcaccgttgccgtcgaaggcggcaaggacagcgaagagtgccgcaag
gttggttacgccatcggccattctccgctggtcaagacggccttcttcgcctccgacccc
aacctcggccgtatcctggccgccgtcggctatgccggtatcaacgacctcgatgtcgat
ggcgtcagggtttggctcgatgaggtgctggtcgccgaaaagggcggtcgtgcggccgcc
tacaaggaagaggacggcgcccgcgtgatggcgcaggctgaaatcactgtgcgcgtcgat
ctcgggcgcggtgcggccaaagccagcgtttatacctgcgatttttcctacgactacgtg
aagatcaacgccgactatcgttcctga

DBGET integrated database retrieval system