KEGG   Dechloromonas aromatica: Daro_3488Help
Entry
Daro_3488         CDS       T00259                                 

Definition
(GenBank) protein translocase subunit secA
  KO
K03070  preprotein translocase subunit SecA
Organism
dar  Dechloromonas aromatica
Pathway
dar02024  Quorum sensing
dar03060  Protein export
dar03070  Bacterial secretion system
Module
dar_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:dar00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Daro_3488
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Daro_3488
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Daro_3488
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dar02044]
    Daro_3488
Secretion system [BR:dar02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   Daro_3488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind SEC-C DEAD Helicase_C MEDS
Motif
Other DBs
NCBI-ProteinID: AAZ48217
UniProt: Q47AB4
Position
complement(3735877..3738591)
Genome map
AA seq 904 aa AA seqDB search
MISGLLKKIFGSRNDRLIKQYSQNVKRINALEPAMQALSDEQLRAKTDEFRQRHANGESL
DDLLPEAFAVVREAGQRALGMRHFDVQMIGGMVLHDGKIAEMRTGEGKTLVGTLPAYLNA
ISGKGVHVITVNDYLATRDSDWMGRLHRFLGLTVGVNLSQMDHEAKQAAYAADITYGTNN
EFGFDYLRDNMVYTAGERVQRSLNFAIVDEVDSILIDEARTPLIISGQAEDHTDLYLRMK
DVVPNLTRAMEEKDEGDYWVDEKGHQVHLSETGYEHAEQLLAEYGLLKEGTSLYDAANIT
LMHHLNAALRGMTLFHKDQHYVVQNGEVVIVDEFTGRLMAGRRWSDGLHQAVEAKEGVQI
QAENQTLASITFQNYFRMYNKLAGMTGTADTEAYEFHQIYGLETVVIPTHRPMVRKDMND
LVYKTADEKHAAIIADIKDCAKRGQPVLVGTTSIEASELLSGLLDKESLPHQVLNAKQHA
REAEIVVQAGRPGMVTIATNMAGRGTDIVLGGNIEKQLAAIRDDESLPVEEREQKAAAMK
AEWQEVHNAVLASGGLHIIGSERHESRRIDNQLRGRAGRQGDAGSSRFYLSLDDPLLRIF
AGERLRAIMDKLKMPEGEAIEHPLVTRSLESAQRKVEARNFDIRKQLLEYDDVSNDQRKV
IYQQRNELLETDDISETITAMRQSVIAETFRTYVPAESVEEQWDMEGLERALASDLQIIA
PVAQWFKDEPTLSDEEILERITKNADEAYQAKIDLVGDGTFHQFERNVMLQSLDSHWREH
LAALDHLRQGIHLRGYAQKNPKQEYKREAFELFEGLLDLVRREVTRVVFTVQIRTPEDVE
ETAPHAEVQNVQYQHAGYDEALGEGEGAEAAGQQPADAGPKIGRNDPCPCGSGKKYKHCH
GKLS
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgatatccggcctactcaaaaagattttcggcagccgcaatgaccggctgatcaagcaa
tactcccagaacgtcaagcgtatcaacgcgctggaacctgccatgcaggccctgagcgat
gaacagttgcgggccaagacagacgagttccgccagcgtcacgccaacggtgagtcgctg
gacgatctgttgccggaggctttcgcggtggttcgcgaagccggtcagcgggcgctcggc
atgcgccacttcgacgtccagatgattggcggcatggtgctgcatgacggcaagattgcc
gaaatgcggaccggcgagggcaagacgctggtcggcaccttgccggcctacctcaatgcc
atttccggcaagggcgttcatgtcatcacggtcaacgactatctggcgacccgcgactcg
gactggatggggcgtctgcaccgcttcctcggcctgaccgtcggcgtgaacctgtcgcag
atggaccacgaggccaagcaggcggcctacgcggctgacatcacctacggtaccaacaac
gaattcggcttcgactacttgcgcgacaatatggtctatacggccggtgagcgcgtccag
cgtagcctgaatttcgccatcgtcgacgaagtggactcgatcctgatcgacgaggcgcgc
accccgctgattatttccggccaggccgaagatcacaccgatctctacctgcggatgaag
gacgtcgtgcccaatctgacgcgggcgatggaagagaaagacgaaggcgactactgggtc
gacgagaagggccatcaggtccatctctccgaaactggctacgagcacgccgagcaactg
ctggccgagtatggcctgctcaaggaaggcaccagcctttacgacgccgccaacatcacg
ctgatgcaccacctgaatgccgccctgcgcggcatgacgctgttccacaaggatcagcat
tacgtcgtgcagaacggtgaagtcgtcatcgtcgacgaattcaccggtcgtctgatggcc
ggtcgtcgctggtccgacggcctgcatcaggcggtcgaagccaaggaaggcgtgcagatt
caggccgagaaccagacgctggcctcgatcactttccagaactacttccggatgtacaac
aagctggccggcatgaccggcacggccgacactgaagcctacgaattccaccagatctac
ggtctggaaacggtcgtcatcccgacccatcggccgatggttcgcaaggacatgaacgat
ctggtctacaagacggccgacgagaagcacgcggcgatcattgccgacatcaaggattgc
gccaaacgcggccagccggtgctggttggcacgacctcgatcgaagcttcggagttgctt
tccggcttgctcgacaaggaaagcctgccgcatcaggtattgaatgccaagcagcatgcc
cgtgaagcagaaatcgtcgtccaggccggtcggccggggatggtgaccatcgccaccaac
atggccggtcgcggtaccgacatcgtgctcggcggcaacatcgaaaaacaactggctgcc
attcgcgatgacgagtcgctgccggtggaggaacgcgagcagaaggctgcggcgatgaag
gccgagtggcaggaagtgcacaatgccgtgctggcttccggcggcctgcacatcatcggt
tccgagcgtcacgaatcgcgccgtatcgacaaccagttgcgtggtcgcgccggtcgtcag
ggcgatgccggttcctcgcgtttctacctgtcgctcgatgatcccttgttgcgcatcttc
gccggcgaacgtctgcgcgccatcatggacaagctgaaaatgccggaaggcgaagcgatc
gagcatccgctcgtcacccgctcgctggagtcggcacagcgcaaggtcgaagcccgcaat
ttcgatatccgcaagcagctgcttgaatacgacgacgtctccaacgaccagcgcaaggtg
atctaccagcagcgtaacgaactgctggaaacggatgatatttccgagaccatcactgcc
atgcgccagagcgtcatcgccgaaaccttccgcacttacgtgccggcagagtcggtcgag
gagcaatgggacatggaagggctagagcgcgccctggcatccgacctgcagatcattgca
ccggtcgcccagtggttcaaggatgagccgaccctgtctgacgaggaaatcctcgagcgc
atcaccaagaatgcggacgaagcctatcaggccaagatcgatctggttggtgacggtacc
ttccaccagttcgagcgcaatgtgatgctgcaaagcctcgattcgcactggcgtgagcat
ctggcggcgctggatcacctgcgtcagggtatccacctgcgtggttatgcccagaaaaat
ccgaagcaggaatacaagcgcgaagctttcgaactgttcgaaggcttgctggatctggtt
cgccgcgaagtgacccgcgtcgtattcaccgtgcagattcgtacgccggaagatgtcgag
gaaactgcaccgcacgccgaagtgcagaacgtccagtatcagcacgccggttacgatgag
gcgctgggtgagggcgaaggcgccgaggctgctggccagcagccggcggatgccgggccg
aagatcggacgcaacgatccctgcccttgcggatcgggcaaaaaatacaaacactgccac
ggaaaactttcctga

DBGET integrated database retrieval system