KEGG   Dechloromonas aromatica: Daro_3518Help
Entry
Daro_3518         CDS       T00259                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase:Pyridine nucleotide-disulfide oxidoreductase, class-II, active site
  KO
K03387  alkyl hydroperoxide reductase subunit F [EC:1.6.4.-]
Organism
dar  Dechloromonas aromatica
Brite
KEGG Orthology (KO) [BR:dar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Daro_3518
Enzymes [BR:dar01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.4  With a disulfide as acceptor
    1.6.4.-  
     Daro_3518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO NAD_binding_8 K_oxygenase FAD_binding_3 Thi4 AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: AAZ48247
UniProt: Q47A84
Position
3767794..3769359
Genome map
AA seq 521 aa AA seqDB search
MLDTAIKGQLKAYLERLQRPIELVGTLDDSAKGQEMRALLNDILECSDKVTLRENGGATR
IPSFAVALPGETPRIHFAGLPMGHEFTSLVLALLQTGGHPPKVEQSVIDQINALPGSFKF
ETYISLSCHNCPDVVQALNLMAVLNPNVTSTMIDGAMFQDEVNARQIMAVPTTYLNDAEF
GAGRMLIEEILAKVDTGATARAAEELGKKETFDVLVVGGGPAGAAAAIYAARKGIRTGIV
AERFGGQVMDTLGIENFISVPYTEGPKLVASLEQHVKEYAVDVMNLQRANKLTPASENGG
LVGLELENGAKLQAKTVILSTGARWREMNVPGENQYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLLEFADTLRADAVLQSKLNSLPNVTVIKSAQTTEVTGDD
QKVNGITYKDRITGEEKHVELEGIFVQIGLLPNTDWLKGSLDLSKFGEIIIDAKGQTSAP
GVFAAGDCTTVPYKQIIIAMGAGATASLSAFDHLIRSSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccgccatcaaaggccaactgaaggcctatctcgaacgcctgcaacgcccc
atcgaactggttggcacgctggatgacagcgccaagggccaggaaatgcgcgccctgctc
aacgacatcctcgaatgctcggacaaggtcaccctgcgtgaaaacggtggcgccacgcgc
attccgtccttcgcggtcgcgctgcccggcgaaacgccgcgcatccacttcgccggcctg
ccgatgggccacgaattcacctcgctggtgctcgccctgctgcaaaccggcggccacccg
cccaaggttgagcaatcagtcatcgaccagatcaatgcgctgcccggcagcttcaagttc
gagacctacatctcgctgtcctgccataactgtccggatgtcgtgcaagccctgaacctg
atggccgtgctcaaccccaacgtgaccagcacgatgatcgatggcgcgatgtttcaggat
gaggtcaacgcccgccagatcatggccgtgccgaccacctacctgaacgacgccgaattc
ggtgccggccgcatgctgatcgaggaaattctcgccaaggtcgataccggcgctacagcc
cgtgccgccgaagaacttggcaaaaaagaaaccttcgacgtgctcgtcgttggtggtggc
ccggcgggcgcggcagcagccatctatgccgctcgcaagggcatccgtaccggcatcgtc
gccgagcgtttcggcggccaggtgatggacacactgggcatcgagaacttcatctcggtg
ccttacaccgaaggcccgaaactggtcgcctcgctggagcagcacgtcaaggaatacgcg
gtcgatgtgatgaacctgcaacgcgccaacaagctgactccggccagcgaaaatggcgga
ctggtggggctcgaacttgaaaacggcgccaagctgcaggccaagacggtgattctttcc
acaggcgcgcgctggcgtgaaatgaacgtgccgggcgagaaccaatacaaggccaagggg
gtctgtttctgcccgcactgtgacggcccgctgttcaagggcaagcgcgtggcagtcatt
ggcggcggcaactccggcgttgaggcagccatcgacctggctggcatcgtcgcccacgtc
acgctgctcgaattcgccgataccctgcgagccgatgctgtgttacagagcaagctcaat
agcctgcccaacgtcacagtgatcaagtcagcgcaaaccaccgaagtcaccggtgacgac
cagaaggtcaacggcattacctacaaggaccgcatcaccggcgaggaaaagcacgtcgaa
ctcgaaggcatcttcgtgcagattggcctgttgccaaacaccgactggttgaagggatcg
ttggacctgagcaagtttggcgaaatcatcattgatgcaaaaggccaaaccagcgccccg
ggcgtcttcgccgccggcgactgcaccacggtgccgtacaagcagatcatcattgccatg
ggcgccggcgccaccgcctcgctcagcgccttcgaccacctgatccgcagctcggccccg
gcctga

DBGET integrated database retrieval system