KEGG   Dechloromonas aromatica: Daro_3525Help
Entry
Daro_3525         CDS       T00259                                 

Definition
(GenBank) C-5 cytosine-specific DNA methylase
  KO
K00558  DNA (cytosine-5)-methyltransferase 1 [EC:2.1.1.37]
Organism
dar  Dechloromonas aromatica
Pathway
dar00270  Cysteine and methionine metabolism
dar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Daro_3525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dar03032]
    Daro_3525
   03036 Chromosome and associated proteins [BR:dar03036]
    Daro_3525
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:dar02048]
    Daro_3525
Enzymes [BR:dar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     Daro_3525
DNA replication proteins [BR:dar03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    Daro_3525
Chromosome and associated proteins [BR:dar03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Daro_3525
Prokaryotic defense system [BR:dar02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    Daro_3525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_methylase DRE2_N
Motif
Other DBs
NCBI-ProteinID: AAZ48254
UniProt: Q47A77
Position
complement(3774763..3776478)
Genome map
AA seq 571 aa AA seqDB search
MTTEVACQHFEVGFECRVTQKMAEKNTMKSTKAKPRAIDLYSGIGGWSLGLEMAGIEVVA
SYEWWDKANRTNHKNNQHLATEIDIRQLRLEDLPKNIDIVVGSPPCTQFSFANRGGSGDI
EDGLKDIAKFLAVVDYVRPKHWAMENVPRVASIIEKEMQIGGRLAHFSHLKPVIKIVDTC
EWGVPQRRQRCIVGNFDFGLLQSYKEHTKPRTLGDVVSVLSQATITDPIYGIEVAREELT
DHVIEEFLSAEEERMNREMKTYHPVYNNMAFPDPLNRTARTITATCTRVSRESVVIAAPE
QKGRFRRLTVRERGCLQGFPITYQFFGDSYAQKLKMIGNAVPPLFTFYVAQAMLGISPET
LIQPNEGIGRFVGTEERPKVTRPDTAGDSYSSTRRFRAALPHLRFKSGVRFELANSFVGS
VPEWRVKFFFGNSKNITELPLSDGLLKKLKASKEVEGVLPQVMTSIAHVDQVISSTDAQT
LQRVWTHTLEHRFHPYDVVDVLGQATEETITLLCKHNRGSEGVIAKILEDMGYPQGSDKV
LKYSDAVLAGLLVGAFANLRFCDPSFSNSKG
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagaagtagcttgccaacactttgaggttggttttgaatgccgagttactcag
aaaatggcagaaaaaaatacgatgaaatccaccaaggcaaaaccacgcgcgattgatctt
tactcagggatcggcgggtggtcactcggccttgaaatggcgggcattgaggtcgttgcg
tcctatgaatggtgggacaaggccaatcgaaccaatcacaaaaataatcaacatctcgct
actgagatcgatatccgacagttgcgactcgaagatttgcccaagaacatcgatattgtg
gttggaagccctccttgcacacagttttccttcgcaaatcgtggaggtagtggcgatatt
gaggatggtctgaaagatatagccaagtttttggcggtggtcgattacgtccgccccaag
cattgggcaatggaaaacgtccctcgtgttgcgagcatcatcgagaaggaaatgcagatt
ggcggtcgtctagcccatttttcccacctgaagccagtaatcaagattgttgatacttgc
gagtggggagtgccacagcgtcgtcagcgctgcatcgttggcaacttcgatttcggccta
ctccagtcgtacaaagagcatacaaagccgcgaacacttggtgacgttgtttccgtactc
tctcaagcaaccataaccgatccgatttacggtatcgaagtggctagagaagagcttacc
gatcacgtgattgaggagttcctctcagcagaagaggagcggatgaatcgggaaatgaag
acctaccacccggtttataacaacatggccttccccgatcccctaaaccgaaccgcaagg
acgattacggcgacctgtacgcgggtatccagagagagcgttgtgattgcagcgcctgaa
cagaagggacgcttcaggcgtttgaccgtgcgtgagcgagggtgtcttcagggattccct
attacttaccagttttttggtgatagctatgctcaaaaactgaagatgattggaaatgca
gttcctccgctctttacgttttacgttgcacaagcgatgttggggatttcgccagagact
ctcattcaacccaatgagggtatcggtcggtttgttgggacagaggagcgccccaaagta
actcgccctgatactgccggtgactcctactcttccaccagacggttcagagcagcactt
cctcatctaaggttcaagagtggggtgcgttttgagctggcaaactcgtttgtcggtagc
gtacctgaatggagggtcaagttcttcttcggtaattcgaagaacattacagaactccct
ctttcagatggccttctgaagaagttgaaagcgtccaaagaggttgagggtgtcttgcct
caagttatgacatcaatcgcccacgtagatcaggtgatttcttcaactgatgcccagacc
cttcaacgtgtctggactcatacgctagagcatcgcttccatccgtacgatgttgttgat
gttctgggtcaggcaacagaggaaacgatcactctcctttgcaagcacaaccgggggtct
gaaggcgtaatcgcgaaaatcctcgaagatatgggttacccacaaggttccgacaaggta
ctcaaatactcggatgcggtacttgcagggttgctggttggagcgtttgcaaatctgcgt
ttctgcgacccctcgttctcaaactctaagggctaa

DBGET integrated database retrieval system