KEGG   Dechloromonas aromatica: Daro_3537Help
Entry
Daro_3537         CDS       T00259                                 

Definition
(GenBank) Phospholipid/glycerol acyltransferase
  KO
K00655  1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
dar  Dechloromonas aromatica
Pathway
dar00561  Glycerolipid metabolism
dar00564  Glycerophospholipid metabolism
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Daro_3537
   00564 Glycerophospholipid metabolism
    Daro_3537
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dar01004]
    Daro_3537
Enzymes [BR:dar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     Daro_3537
Lipid biosynthesis proteins [BR:dar01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   Daro_3537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-ProteinID: AAZ48266
UniProt: Q47A65
Position
3788873..3789625
Genome map
AA seq 250 aa AA seqDB search
MKTLRSTVFMAYALVWSILTAPLVVIAALALRGLWGYRFGKLWRLGIQFGVENILGIRPK
VIGLENMPQEPCVILAKHQSAWETMTLQDYVPNGAYCVFVLKKELLKVPLVGWGLAAMKM
ISIDRAAGKEALDQVVIQGRERLQQGFYVILFPEGTRVAPGHKKRYKPGGAYLATRVGCK
VVPIAHNAGELWPRQAFLKTPGTVTVSIGPAFDATGMTEAEVNQKAEAWIEDEMHRISPH
RYSDAQHNAT
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccctgcgctccacggtcttcatggcctacgccttggtctggtcgatcctgact
gcgccgctcgtcgtcatcgccgcactggccctgcgcggcctgtggggctaccgtttcggc
aagctgtggcgccttggcatccagttcggcgtcgagaacatcctgggcatccgccccaag
gtcatcggcctggaaaacatgccgcaggaaccctgcgtcattctcgccaagcaccagtcg
gcctgggaaaccatgaccttgcaggactatgtaccgaatggcgcttactgcgttttcgta
ctcaagaaggaattgctcaaggtgccgctggtcggctggggcctggctgcgatgaagatg
atttccatcgaccgtgccgccggcaaggaggcactcgatcaggtcgttatccagggtcgc
gagcgcctgcagcagggtttctacgtcattctcttcccggaaggcacgcgcgtcgcaccg
ggccacaagaaacgctacaagccaggcggcgcctatctcgccacccgggttggctgcaag
gtcgtgccgattgcccacaatgcaggcgaactgtggccgcgccaggctttcctgaaaacg
ccgggcaccgtcaccgtcagcattggcccggccttcgacgccaccggcatgaccgaagcc
gaggtcaaccagaaggccgaagcctggatcgaagacgaaatgcaccgcatctcgccgcac
cgttactcggatgcccagcacaacgccacctga

DBGET integrated database retrieval system