KEGG   Dechloromonas aromatica: Daro_3540Help
Entry
Daro_3540         CDS       T00259                                 

Definition
(GenBank) amino acid/amide ABC transporter substrate-binding protein, HAAT family
Organism
dar  Dechloromonas aromatica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_6 ANF_receptor Peripla_BP_5
Motif
Other DBs
NCBI-ProteinID: AAZ48269
UniProt: Q47A62
Position
complement(3790830..3791963)
Genome map
AA seq 377 aa AA seqDB search
MNWKLVVRGVVGVLGVVSSSFVMAETGVSDSTILVGQSVPLSGPSQELGSEMKLGVQLYF
DQVNSQGGINGRKLELKVLDDGYEPERTAANTRQLIGKEGVFSLLGFVGTPTSVAALQVS
NPAKVPFVGAFTGADALRVPFNRYVFNIRASYAEECERIVEQFTSLNVKRIAVFFQNDGF
GKAVLSGVERAMEKRGLQVINSTAIERNSLNVAPAAKAIAAVRPDMVIMAVPYKPSAAFI
NAIRGEGAAPQFYTVSFVGPQALAKELGPNGAGVGISQVMPFPWSINAPIVREYQKLLQG
KAEPSYVSLEGFIAAKVFVEGVKRAGKDLTREKLIGAMEGMHSYDTGGYAVSFGPNDHNG
SKFVELTVLRRDGKIMR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaactggaagctggtggtcaggggggtagtcggggtgctgggcgttgtttcctcaagt
ttcgtcatggctgagacaggcgtaagcgatagcacgattttggtcggccagtctgttccg
ctcagcggcccgtcgcaggaactgggcagcgagatgaaactgggggtccagctttatttt
gaccaggtgaatagccaggggggcatcaacggtcgaaagctggaactgaaggtattggat
gatggctatgagccggaacgcaccgccgccaatacgcgtcagctgatcggaaaagagggc
gtattttccttgcttggttttgtcggaacaccgaccagtgtcgcagcactgcaggtttcg
aatccagccaaagtgccttttgttggtgctttcaccggcgctgatgccttgcgcgtaccg
ttcaatcggtacgtattcaatatccgggcaagctacgccgaggagtgcgagcggattgtc
gagcagttcacttcgctgaacgtcaagcgcattgccgtgtttttccagaacgatggcttc
ggcaaggctgttctgagtggcgtcgagcgagcgatggaaaagcgaggcttgcaggtaatc
aatagcaccgctatcgaacggaattcgctgaacgttgctcccgcggcaaaagcgattgcc
gcagttcgcccggacatggtgatcatggctgtcccctacaagcccagcgcagcctttatc
aacgcgattcgcggcgaaggcgccgcaccgcagttctatacggtttcgtttgtcgggccg
caagccctggccaaggaacttgggcccaatggcgcgggggtgggcatttcccaagtgatg
cctttcccttggtcgatcaacgcgccgattgttcgtgagtatcagaagttgctgcagggc
aaggctgaaccctcatacgtcagcctggaaggcttcatcgcggcgaaagtttttgtcgaa
ggggtgaaacgcgccggcaaggatctgacccgtgaaaagctcatcggtgccatggaaggg
atgcacagctacgataccggtggttatgccgtcagctttggtccaaacgatcataacggc
tcgaaattcgtcgaactgacggttctgcgccgtgatgggaaaatcatgcgctga

DBGET integrated database retrieval system