KEGG   Dechloromonas aromatica: Daro_3541Help
Entry
Daro_3541         CDS       T00259                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dar  Dechloromonas aromatica
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ48270
UniProt: Q47A61
Position
3792252..3792866
Genome map
AA seq 204 aa AA seqDB search
MPLPDFFAQIPAITLRDPLAELLGAADGGLIEYTFADAVKLAGHSCPTVAGAWLMSVRAL
GELYGSETPVRGNIAVALQDDLDSGVAGVIASIATLLTGAAGDGGFKGLGGQHARRGLLK
FGVAEVMGMRFRRLDTGAAVDCVFRPHLVPADPMLGKLLPGIVSGAANAAETGLFGKLWQ
DRVKRLLIDHGDDPAVVEIKRIPH
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgccgctacccgatttttttgcccagattcctgcgatcaccctgcgcgacccgctggct
gaactgcttggtgcggccgatggtggactgatcgagtacacctttgccgatgccgtcaaa
ctggccgggcattcctgccccaccgtggccggggcatggctgatgagcgtccgggcgcta
ggcgagctatacggcagcgaaacgccggtacgcggcaatatcgccgtcgccttgcaagac
gatctcgacagtggcgtggccggggttatcgccagcattgctaccttgctgaccggtgcc
gccggcgatgggggcttcaaggggctcggcgggcaacatgcccggcggggcttgctaaag
tttggcgttgccgaggtcatgggcatgcgctttcggcgcctcgataccggcgctgcggtc
gactgcgtttttcggcctcatctggtgcccgccgaccccatgctcggcaaattattacca
ggaatcgtcagcggcgcggccaacgccgccgaaaccgggctcttcggaaagctctggcag
gatcgcgtcaaacgcctgctgatcgatcacggcgacgatcctgccgtcgtcgaaattaag
cgcattccccattag

DBGET integrated database retrieval system