KEGG   Dechloromonas aromatica: Daro_3546Help
Entry
Daro_3546         CDS       T00259                                 

Definition
(GenBank) Cyclic nucleotide-binding protein
Organism
dar  Dechloromonas aromatica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cNMP_binding
Motif
Other DBs
NCBI-ProteinID: AAZ48275
UniProt: Q47A56
Position
3796417..3796791
Genome map
AA seq 124 aa AA seqDB search
MISIELFAHNPTMIRVPAGQALFREGEEGHMMFVLATGSADVVVHERVVETLQHGSIVGE
VGIVLPGPRSASVIATTDCEFVAVDEKRFQFLVQQTPFFATQVMRVMAERLRNLNQLVTP
IEDI
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgatttccatcgaactcttcgcccacaatccaaccatgattcgcgtcccggccggccag
gccctgttccgtgaaggcgaagaaggacacatgatgttcgtgctggccaccggctcggcc
gacgtcgtcgtccatgagcgggtcgttgaaaccttgcagcacggcagcatcgtcggcgaa
gtcggcatcgtcctgcccgggccacgttcggccagcgtgatcgcgacgacggattgcgaa
ttcgtcgccgtcgatgaaaagcgtttccagttcctggtccagcagaccccgttcttcgcc
acccaggtcatgcgggtgatggctgaacgactgcgcaacctgaatcagctggtcacgccg
atcgaagatatttag

DBGET integrated database retrieval system