KEGG   Dechloromonas aromatica: Daro_3550Help
Entry
Daro_3550         CDS       T00259                                 

Definition
(GenBank) Phosphoesterase, PA-phosphatase related protein
Organism
dar  Dechloromonas aromatica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAP2 PAP2_3 PAP2_C
Motif
Other DBs
NCBI-ProteinID: AAZ48279
UniProt: Q47A52
Position
complement(3802391..3803227)
Genome map
AA seq 278 aa AA seqDB search
MDCGLYARHRWFDRMVWVSCLLLAMALFGIWFTGKWQAGFIPAQAASAVLPPVLWESLTT
LGDARVQLALMLPFCLRYPRVFWALFLGALLAGAISRGFKTAVPLPRPAAVLDAAQINVI
GAKLTAHSFPSGHTVSAFSFVVPWLALLGWRAAPIVLIAALAGFSRIAVGAHWPVDVLAG
AMIGLAGSWLGLRLSRRFPWGLGVRAHWFLVAISLVAVATLPFDGQGYPGSLPWRVAACL
WGLGGFVLVYLLPLFRLGWQGVNRELASVAVPGGEISR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggattgcgggctgtacgcccggcatcgctggttcgacaggatggtatgggtgtcctgc
ctgttgctggcaatggcgctgttcggcatttggttcactggcaagtggcaggctggtttc
atcccggcgcaggcggccagcgccgtgcttcctccggtgctctgggagtcactgacgact
ttgggcgacgcccgcgtgcagttggcgctgatgttgcctttctgtctgcgttatccccgg
gtgttctgggcgctctttctcggtgccctgcttgccggggcaatcagccgtggcttcaag
acggccgtgcctttgcctcgccccgcagcggtgctcgatgctgcgcagatcaatgtcatt
ggtgccaagctgacggcgcacagctttccgtccggacataccgtctctgccttctccttt
gtcgtcccctggctggccttgctcggctggcgggcggccccgattgtgctgatcgctgcc
ttggccggtttctcgcggattgccgttggcgcccactggccggtcgatgtgctggccggt
gccatgatcggcctcgccggcagttggctaggcttgcgtttgagccgccgcttcccctgg
gggctgggggtgcgcgctcactggttcctggtggcgatttcgctggtggccgtcgccacc
ttgcctttcgatggtcagggctaccccggttctttgccctggcgcgtcgccgcttgcttg
tgggggcttggcggtttcgtgctggtctatctgctgcccttgttccgcctggggtggcag
ggggtgaatcgtgaactggccagtgtcgccgtgccgggcggcgaaatctcccgctga

DBGET integrated database retrieval system