KEGG   Dechloromonas aromatica: Daro_3554Help
Entry
Daro_3554         CDS       T00259                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dar  Dechloromonas aromatica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4239 Glucos_trans_II
Motif
Other DBs
NCBI-ProteinID: AAZ48283
UniProt: Q47A48
Position
complement(3807555..3808331)
Genome map
AA seq 258 aa AA seqDB search
MPTSNWHIYDHYGYAFLAVAGTFAAVAAVQWALRRPRWAGWIASLQGVAPPFINIIGVLF
GLTLAFLANDTWSAHDRAMNAVFKEADSLRSIRVLSEQLAEPLRGEVRLALSRYGQASAG
EWPMLAARQSSTEVTSLADALLTLLASQKVAAGAGENVQALMLRKAVEIRDERDLRIGLS
QTHVNPLKWLGMAFLGFLTLLSVSVVHVDKPRAAMVAVILFALAAAPTAAIVLIQGNPFQ
QPTSVNPAPIIEAVSGQH
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccagcaactggcatatctacgatcactacggctacgccttcctcgccgtggcc
ggtacttttgccgccgtcgctgcggttcagtgggcgctgcgccgcccacgctgggcgggc
tggatcgcttcgctgcaaggcgtggcaccgcctttcatcaatattatcggggtgctgttc
ggtctgaccctggccttcctggccaatgacacctggagtgcccatgaccgggcgatgaat
gccgtgttcaaggaggccgattcgctgcgcagcattcgtgtgctgtcggaacagctggcc
gagccgctgcggggtgaagtgcgcctggcgctttcccgctacggtcaggccagcgccggt
gaatggccgatgctggcggcccgccagtcgagtaccgaagtgacttcgctggccgatgcg
ctgctgaccctgcttgccagccaaaaggttgctgccggtgccggcgagaacgtgcaggcg
ctgatgctgcgcaaggcggtcgaaattcgtgacgagcgtgacttgcgcatcggcctcagc
cagacccacgtcaatccgctcaagtggctaggcatggctttccttggcttcctgaccctg
ctgtcggtctcggtcgttcatgtcgacaagccgcgggcagcgatggttgcggtgatcctg
ttcgccttggcggcggcgccgacggctgcgattgtgctgatccagggcaatcccttccag
cagcctacttcggtcaatccggcgccgattatcgaggcagttagcggtcagcattaa

DBGET integrated database retrieval system