KEGG   Dechloromonas aromatica: Daro_3558Help
Entry
Daro_3558         CDS       T00259                                 

Definition
(GenBank) ATP-binding region, ATPase-like:Histidine kinase A, N-terminal
  KO
K07646  two-component system, OmpR family, sensor histidine kinase KdpD [EC:2.7.13.3]
Organism
dar  Dechloromonas aromatica
Pathway
dar02020  Two-component system
Module
dar_M00454  KdpD-KdpE (potassium transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:dar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Daro_3558
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dar01001]
    Daro_3558
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dar02022]
    Daro_3558
Enzymes [BR:dar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Daro_3558
Protein kinases [BR:dar01001]
 Histidine kinases
  OmpR family
   Daro_3558
Two-component system [BR:dar02022]
 OmpR family
  KdpD-KdpE [MD:M00454]
   Daro_3558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4118 HATPase_c HisKA GAF_3 GAF_2 HATPase_c_2 DUF5418 DUF106 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AAZ48287
UniProt: Q47A44
Position
complement(3812501..3814039)
Genome map
AA seq 512 aa AA seqDB search
MENNASLLDESPERITPKQGWVLTILACVGTTIIATPLLGYLDLANIVMLFLLTVLLVAV
KLGRNAAILASILSVLLFDIFFVPPRFSLAVSNIQYLVTFAVMLVTALITAHLAAGLRQR
ARESQSREKRTQALYQFARELAGTLTTEQVVEISRSFIKTQLNAQSAVLMPHPENERLMV
VSSSESPLLEMHLAQVALKSGQLVRSDEVGGMGYAPLYLPLRASMRIRGVLAIRFADDVA
EPSSETTSLLETLASLIAVAVERLHYVDVAQASEVKMLTERLRSSILSALSHDLRTPLTA
MVGLADSLFLIKPALPATALETAQALHEQADRLAGLVGNLLDMARLNAGEVTLRREWQPL
EEVVGAGIKLLGSALASHPVKVELPRDLPLLEFDAVLIERVLCNLLENAAKYSPDGTPLL
LAAEQEMDVVRVSISDHGPGFPAKRRDDLFKMFVRGESESGKPGTGLGLAICKAIVEAHG
GTITADNRPDGGACVSFTLPKGVPPVVEEELA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaatgcctcattgctggacgaaagtccggaaagaatcaccccgaaacagggc
tgggttctcaccattctggcctgtgtcggcacgacgatcatcgccacgccgctgctgggt
tatctcgacttggccaatatcgtcatgctcttcctgctgaccgttctgctggtcgcggtg
aagctgggccgcaatgcggccatcctggcctccattctgagcgttcttctgttcgatatt
ttctttgtcccaccgcgcttttcactggcggtcagcaatatccagtatctggtcaccttc
gccgtgatgctggtcactgcgctgattacggcccaccttgcggcgggattgaggcagcgg
gcacgggaatctcagtcgcgcgaaaaacgaacccaggccctgtaccaatttgcgcgtgaa
ctggccggtaccctgacgaccgagcaagtcgtggaaatttcccgctcgttcatcaagacg
caactgaatgcccagtccgccgtcctgatgccgcatccggaaaatgaacgtctgatggtt
gtttcatcatcggaatccccgcttcttgagatgcatcttgcccaagtcgccttgaaaagc
ggccaactggtgcgtagcgacgaagtgggtggcatggggtatgcgccgctttatctgccg
ctgcgcgcctcgatgcggattcgcggcgtgctcgccatccggttcgccgacgatgtggct
gagccttcctccgaaaccacctcgctactggaaaccctggcctccctgatcgcggtggcc
gtggagcgactccactacgttgatgtggcgcaggcctctgaagtcaaaatgctgaccgag
cgcttgcgtagctccatcctgtcggcgctttcgcacgacctgcgcacaccactgactgcc
atggtcggcttggctgactccctgttcctgatcaagccggcattacctgccacggcactt
gaaacggcacaggcattgcatgagcaggccgaccggctggccggtctggtgggcaatctt
ctcgacatggcccgcctgaatgccggcgaagtgacgttgcgccgtgagtggcaaccgctc
gaagaagttgtcggggcaggcatcaagttattgggcagtgccttggcctcgcacccggtc
aaagtcgaactccccagggatttgcctctcctcgagtttgacgccgtcctgatcgaacgt
gtgttgtgcaatctccttgagaatgccgccaaatattcccccgatggcaccccccttctg
ctggcagccgaacaggagatggatgtggttcgggtgagtatcagcgaccatggcccgggg
tttccggcaaaacggcgtgacgacctgttcaagatgtttgtccggggcgaaagtgaatcc
ggcaagccgggaaccgggctcggcctcgccatctgcaaagccatcgtcgaagcgcatggc
ggaacaatcactgccgataaccggcccgacggcggggcctgtgtcagctttactttgccg
aagggtgtgccgccggtagtcgaggaggagttggcatga

DBGET integrated database retrieval system