KEGG   Dechloromonas aromatica: Daro_3559Help
Entry
Daro_3559         CDS       T00259                                 

Definition
(GenBank) hypothetical protein
Organism
dar  Dechloromonas aromatica
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ48288
UniProt: Q47A43
Position
complement(3814317..3814880)
Genome map
AA seq 187 aa AA seqDB search
MFLSAHEIARSREHALSNFIGLSAACIEATRRFSELFSSSSREAIQHGSKHFALFGHGQL
ESITQFPASAWLEHSARASRLLDSSLEILGETQKAMIRSAEAQVQVFDEMVFAVINRTSR
TSPWEAAIALSAMKTTLQGAEQTLHSMSEAAIETVELAEHEAHQVVETLAESKPAPRKRA
VVRSASK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtttctctctgcccacgaaatcgcccggagccgcgagcacgccctgagcaacttcatc
ggcttgtcggcggcctgtatcgaagcgactcggcgcttctccgagttgttttcgtcttcc
agtcgcgaagcgattcagcatggtagcaagcatttcgccctgttcggccacggccagctt
gaatcgatcacccagtttccggcgtcggcctggctggagcacagcgcccgagccagtcgt
ttgctcgacagttcgctggaaattctcggcgaaacgcaaaaggcaatgatccgtagcgcc
gaagcgcaggtccaggtatttgacgaaatggttttcgcggtgatcaaccgtacttcgaga
accagtccatgggaggctgcaatcgccctgagcgcaatgaaaaccacgctccagggggcc
gaacagacattgcacagcatgagcgaggccgccatcgaaaccgtcgaactggccgagcac
gaagcgcatcaggtggtcgaaaccctggcggaaagcaagccggccccccgcaagcgcgct
gtcgttcgcagcgccagcaaatga

DBGET integrated database retrieval system