KEGG   Dechloromonas aromatica: Daro_3560Help
Entry
Daro_3560         CDS       T00259                                 

Definition
(GenBank) ribose-5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
dar  Dechloromonas aromatica
Pathway
dar00030  Pentose phosphate pathway
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01120  Microbial metabolism in diverse environments
dar01130  Biosynthesis of antibiotics
dar01200  Carbon metabolism
dar01230  Biosynthesis of amino acids
Module
dar_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
dar_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Daro_3560
Enzymes [BR:dar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Daro_3560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A Sugar-bind DeoRC ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AAZ48289
UniProt: Q47A42
Position
complement(3814942..3815640)
Genome map
AA seq 232 aa AA seqDB search
MRSKPFRSITMTQDELKQAVAQAAADYVAQTAPAGSIIGVGTGSTANFFIDALAPLKDKY
KGAVASSEATRKRLEGHGIAVYDLNDVEDIPVYVDGADEIDAGLNMIKGGGGALTREKIV
AAVAREFVCICDGSKLVDTMGKFPLPVEVIPMARAHVARELAKLGGTPVLREGFVTDNGN
IILDVKGLSITDPKGLEAQINQITGVVTNGLFAVRPANLLLLGTADGVRTIR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcaaaccattcaggagcatcaccatgacccaggacgaactcaagcaggccgtt
gcccaggccgccgccgattacgtggcgcagaccgccccggccggcagcattatcggcgtt
ggcaccggctcgacggccaatttcttcatcgatgcgctggcgccgctcaaggacaagtac
aagggcgccgtcgccagttcggaagcgacccgcaagcgcctcgaaggccatggcatcgca
gtctacgacctcaatgatgttgaagatattcccgtctatgttgatggcgctgacgaaatc
gacgccggcctgaacatgatcaagggtggtggcggtgcgctgactcgcgaaaagatcgtc
gcggccgtggctcgtgagttcgtctgcatctgtgacggctccaagctggtcgacaccatg
ggcaagtttccactgccggttgaggtcatcccgatggcccgcgcccatgttgcccgcgaa
ctggccaagctgggtggtacgccggtgctgcgcgagggttttgtgaccgataacggcaat
atcattctcgacgtcaaaggcctgtcgattaccgacccgaaggggctggaagcgcaaatc
aaccagatcaccggcgtcgtcaccaatgggctgtttgccgttcgcccggccaacctgttg
ctgctcggcacggctgacggcgtcaggaccattcgctga

DBGET integrated database retrieval system