KEGG   Dechloromonas aromatica: Daro_3563Help
Entry
Daro_3563         CDS       T00259                                 

Definition
(GenBank) phosphate ABC transporter membrane protein 1, PhoT family
  KO
K02037  phosphate transport system permease protein
Organism
dar  Dechloromonas aromatica
Pathway
dar02010  ABC transporters
Module
dar_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:dar00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Daro_3563
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dar02000]
    Daro_3563
Transporters [BR:dar02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    Daro_3563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF5368
Motif
Other DBs
NCBI-ProteinID: AAZ48292
UniProt: Q47A39
Position
3817505..3818440
Genome map
AA seq 311 aa AA seqDB search
MTANNASDLPVVSDRLSKNAMRHVSERLIESLLFAAAAVSVLTTIGIVYVLVSESIHFFQ
NVSIVDFLTDTQWTPLFDDAHFGIMVLVSGTVVSSLVALAVAIPMGTIIAIYLSEFANGK
VREVAKPILELLGGIPTIVFGYFALLMVTPLLQKFFPELPGFSLLSAGLVMGIMIVPYIA
SLSEDAMRAVPMSLREGSYAMGGTRLYTALHVVVPAAFSGLAASYILAISRAVGETMILA
VAAGMQPNLTWNPAEPAATITSYIVQVALGDLPHGSIGYQTIFAAGLTLILITLCFNILG
QWLRRKFRENY
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaataacgcttccgacctgcccgtggtcagcgatcgcctctcgaagaacgcc
atgcgccacgtcagcgaacggctgatcgagtcgctgctcttcgcggctgctgctgtttcg
gtgctgaccaccatcggcatcgtctatgtactcgtttccgagtccatccattttttccag
aatgtcagcatcgtcgacttcctgaccgacacccaatggacgccgctgttcgatgatgcc
cacttcggcatcatggtgctggtgtccggcaccgtcgtttcctctcttgtcgcactggct
gtggccattccgatggggacgatcattgccatctacctgtccgaattcgccaacggcaag
gtgcgtgaagtggccaagccaattctcgaactgctcggcggcatcccgaccatcgttttc
ggctactttgcgctgctgatggtcaccccactgctgcaaaagtttttcccggaactgccg
ggcttctcgctgctttccgccggcctggtcatgggcatcatgatcgtgccctacatcgcc
tcactgtccgaagatgccatgcgtgccgtgccgatgagcctgcgcgaaggctcctacgcc
atgggcggcacccgtctctacacggcgctccatgtcgtcgtgccggccgccttctccggt
cttgccgcctcctacatcctggccatttcgcgcgcggttggcgaaacgatgattctcgcc
gtcgccgccggcatgcagccgaacctgacctggaatccggccgaaccggctgccacgatc
acttcctacatcgttcaggtcgcgctcggcgacctgccgcacggctcgattggttaccag
accatcttcgcggccggcctgacgctgatcctgatcaccctctgcttcaacattctcggc
cagtggctgcgccgcaaattccgggagaactactaa

DBGET integrated database retrieval system