KEGG   Dechloromonas aromatica: Daro_3566Help
Entry
Daro_3566         CDS       T00259                                 

Definition
(GenBank) phosphate uptake regulator, PhoU
  KO
K02039  phosphate transport system protein
Organism
dar  Dechloromonas aromatica
Brite
KEGG Orthology (KO) [BR:dar00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Daro_3566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoU DUF1732
Motif
Other DBs
NCBI-ProteinID: AAZ48295
UniProt: Q47A36
Position
3820228..3820917
Genome map
AA seq 229 aa AA seqDB search
MNESQHLSSQFDEELNRLRTHVLQMGGLVETQVSAAIEAYSTGEIASVKSIVETDRKVNE
LEKAIDDDCAHIIAKRQPTASDLRLILGISKIVTDLERAGDEAKKIAKGVRRIYENGHLP
GQYGVGIRHLAEAALAMVRRALDAFARLDTPQAADVIRADTDVDAEFKSIIRQLITHMME
DPRTITTSIDIIWIARAIERIGDHAKNISEQVVYVVEGRDIRHTKEKVQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagagccaacacctttccagccagtttgacgaagaactcaaccgtttgcgcacc
cacgtgctgcaaatgggcggcctggtcgaaacccaggtttccgcagccatcgaagcctat
tccaccggcgaaatcgccagcgtcaagagcattgtcgagaccgaccgcaaggtcaatgaa
ctcgaaaaagcgatcgacgacgactgcgcccacatcattgccaagcgccagccgacggcc
tccgacctgcgcctgatcctcggcatcagcaagatcgtcaccgatctggagcgggctggc
gacgaagccaagaaaatcgccaagggcgttcgccgcatctatgaaaatggccatctgccc
ggccaatacggtgtcggcatccgccacctggccgaagctgcgctggccatggtgcgccgg
gcactggacgcctttgcccgcctcgatacgccgcaagcggccgatgtcattcgtgccgat
accgatgtcgatgctgaattcaagtcgatcatccgccagctgatcacgcacatgatggaa
gatccgcgcaccatcaccacgtccatcgacatcatctggatcgcccgcgccatcgagcgt
atcggcgaccacgccaagaacatttccgagcaggtggtctatgtcgttgaaggccgcgac
atacgtcataccaaggagaaggtccagtga

DBGET integrated database retrieval system