KEGG   Dechloromonas aromatica: Daro_3568Help
Entry
Daro_3568         CDS       T00259                                 

Definition
(GenBank) PAS/PAC sensor signal transduction histidine kinase
  KO
K07636  two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
dar  Dechloromonas aromatica
Pathway
dar02020  Two-component system
Module
dar_M00434  PhoR-PhoB (phosphate starvation response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:dar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Daro_3568
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dar01001]
    Daro_3568
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dar02022]
    Daro_3568
Enzymes [BR:dar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Daro_3568
Protein kinases [BR:dar01001]
 Histidine kinases
  OmpR family
   Daro_3568
Two-component system [BR:dar02022]
 OmpR family
  PhoR-PhoB (phosphate) [MD:M00434]
   Daro_3568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA DUF3329 HATPase_c_2 PAS PAS_8 HATPase_c_3 PAS_9 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AAZ48297
UniProt: Q47A34
Position
3821606..3822898
Genome map
AA seq 430 aa AA seqDB search
MSSQLIRALLLALLSSVVALPIGYFVAHWAGWTVFCLGLALQMVFHFRNFARLDRWSHNP
VVDASLEGEGAWDGIFGRLYRHEKDLREQIAQRDHEIAMLIAAGQALTDGVVLLDLHDQI
IFCNTTAETQLGLVIRTDRGQSVANIVRQPEFVAYLEEGDFSRPLTMRTERREDRVFSIH
IIPYAGNRRLMQIKDVTQTDRLDRMRRDFVANVSHELRTPLTVLAGFLETLEEFDVDREE
RNRYINMMSEQSKRMQSIVQDLLTLSSIESAPPPENDPVDMVNLLDKLRRDAEALSAGRH
TIIVETDGQGDLRGSEPELISAFGNLVANAVRYTPAGGTIRISWHATPQGAEFAVQDTGI
GIDPKHIPRLTERFYRVDRGRSRDAGGTGLGLAIVKHSLNRHQAQLEVKSTPGTGSRFAA
KFPASRVAGL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcgcaactgatccgggcgctgctgctggccttgttgtcctccgtcgttgcgctg
cccatcggttatttcgtggcccactgggcgggatggacggtgttctgcctgggcctggcc
ctgcagatggtcttccatttccgcaacttcgcccgtctcgaccgctggtcacacaatccg
gtggtcgatgccagcctggaaggcgaaggcgcctgggatggcatttttggccgcctctat
cgtcacgaaaaagatctacgtgaacagatcgcccagcgcgaccacgaaattgcgatgctg
atcgccgccggccaggcgctgaccgacggcgtcgtcctgctcgatctgcacgaccagatt
atcttctgcaataccaccgccgaaacgcagcttggtctggtcattcgcacggaccgcggg
caatccgtcgccaacatcgtccgccagccggaattcgtcgcctatcttgaagagggtgat
ttcagccgcccgctgaccatgcgtaccgagcgccgtgaggaccgagtcttctcgatccac
atcattccctatgccggcaaccggcgcctcatgcagatcaaggatgtcacgcagaccgac
cgcctcgaccgcatgcgccgcgatttcgtcgccaatgtatcgcacgaactacgtacgcca
ctgaccgtgctcgccggcttcctcgaaacacttgaggaattcgacgtcgaccgcgaggaa
agaaaccgctacatcaacatgatgagcgagcagtcaaagcgcatgcagtccatcgtccag
gacctgctgacgctttcctcaatcgaatcagcgccaccgccggagaacgacccggtcgat
atggtcaacctgctcgacaagctgcgccgggatgcggaagcgctgtcggcagggcgtcac
accatcatcgtcgaaaccgatggccagggcgatctgcggggctcggaacccgaactgatc
agcgccttcggcaacctggtcgccaacgcggtgcgctatacgccggccggcggcaccatc
cggatcagctggcatgccacgccgcaaggcgccgaattcgcggttcaggataccggcatc
ggcatcgaccccaaacacatcccccgcctgaccgagcgcttctaccgcgtcgatcggggt
cgctctcgcgatgcgggtggcaccgggctgggtctggccatcgtcaagcactcgctgaac
cgccaccaggcccaactcgaggtcaagagcacgccgggcaccggcagccgctttgccgca
aaattcccggccagtcgcgtcgccggcctgtag

DBGET integrated database retrieval system