KEGG   Dechloromonas aromatica: Daro_3593Help
Entry
Daro_3593         CDS       T00259                                 

Definition
(GenBank) Glyceraldehyde 3-phosphate dehydrogenase
  KO
K03472  D-erythrose 4-phosphate dehydrogenase [EC:1.2.1.72]
Organism
dar  Dechloromonas aromatica
Pathway
dar00750  Vitamin B6 metabolism
dar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Daro_3593
Enzymes [BR:dar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.72  erythrose-4-phosphate dehydrogenase
     Daro_3593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AAZ48322
UniProt: Q47A09
Position
3849935..3850984
Genome map
AA seq 349 aa AA seqDB search
MPFNVPNTAPLRLAINGYGRIGRCFLRALLESSVAHKLQVVAINEPANLESMAYLTRFDS
THGRFPGNVEITGDKLLIDDQPIRVSHARTPEEVDWSNIDLVVECSGIYGRRPELTRFLD
AGCPRLLLSHPGLSADDVDATIVTGINQQSLTGKERLVSAASCTTNAIVPLLDLIDREIG
IEQAMLTTLHSVMNDQPLIDGYHHDDLRRTRSAMQSIIPVSTGLARGVERLLPQLAGRVQ
AKAIRVPTTNVSAIDLTINTQRPMSAHSINTLLANAAHGPLKKLVAYSEAAHASIDFNHD
PHSAIVDGSQTRTSGTHLVNLFVWFDNEWGFANRMLEVADHWSRLWPTR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttgcccttcaacgtgcccaatactgccccactgcgtcttgccatcaacggttatggccgt
atcggtcgctgtttcctgcgtgcactactggagtcctcggtcgcacataagcttcaggtc
gtcgccatcaatgagccggccaacctggagagcatggcctacctgacccgcttcgattcg
acgcacggccgctttcccggcaatgtcgagatcaccggcgacaaactgctgattgatgac
cagcccattcgcgtcagtcacgcccggaccccggaagaagtggactggagcaacatcgat
ctggtcgtcgagtgctcaggcatctacggccggcgcccggaactgacccgttttctcgat
gctggttgcccgcgtctgctgctgtcccacccgggtctcagcgctgacgatgtcgatgcc
accattgtcaccggcatcaaccagcagtcgctgaccggcaaggagcggctggtttcggcc
gcctcctgcacgaccaatgccatcgtgccgctgctcgacctgatcgatcgcgagatcggc
atcgaacaggccatgctgaccacgctgcattcggtcatgaacgaccagccgctgatcgac
ggctatcatcacgatgacctgcggcgcacccgttccgccatgcagtcgatcatcccggta
tcgaccggcctggcccgtggcgtcgaacgcctgttgccgcaactggccggccgcgtccag
gccaaggcgatccgcgtgccgacgaccaatgtctcggccatcgacctgacgatcaatacc
cagcgcccgatgtcggcgcacagtatcaataccctgctggccaacgctgcccatggcccg
ctgaagaaactggtcgcctattccgaggccgcccacgcctcgatcgatttcaatcacgac
ccgcattcggccatcgtcgatggcagccagacgcggaccagcggcacgcacctggtcaac
ctgttcgtctggttcgacaacgaatggggcttcgccaaccgcatgctcgaggtcgccgac
cattggtcgcggctttggccaacgcggtag

DBGET integrated database retrieval system