KEGG   Dechloromonas aromatica: Daro_3597Help
Entry
Daro_3597         CDS       T00259                                 

Definition
(GenBank) OmpA/MotB
Organism
dar  Dechloromonas aromatica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpA Pilus_CpaD
Motif
Other DBs
NCBI-ProteinID: AAZ48326
UniProt: Q47A05
Position
complement(3854917..3855498)
Genome map
AA seq 193 aa AA seqDB search
MKLLTLLFSTLFLAACAQERYVLLPDASGQSGRLLVKPRQSPPLTLDQPNALSTSGFWGI
GQRRAEADEVKAIWGGSLAATPQPPKKFMLYFLEGTSELTADSKKELDGVFDEIKKRKVT
DIVVIGHTDTVGSQESNDRLAEARAKAMQAELEHLGVDAGSIKVSGRGEREPLVKTADEV
AEPLNRRVEIQVR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgctcaccttgcttttcagtactctgttccttgccgcttgcgcacaagagcgc
tacgtcttgctgcccgatgcgtccgggcaaagcggcaggctgctggttaagcccaggcaa
tcgccgccgctcacccttgatcaacccaatgccttgtcgacctccggtttctgggggatt
ggccagcggcgggcagaggccgacgaggttaaggccatttggggcggctccctggcggcg
actccccagcccccaaagaaattcatgctgtatttcctcgaagggaccagcgagttgacc
gcggattcgaaaaaagaactggacggtgttttcgacgaaatcaagaaacgcaaggtgact
gatatcgtggtcatcggtcataccgacacggtcggttcgcaggagtccaatgatcgtctg
gccgaggccagagccaaggccatgcaggcggaactggagcacctcggtgtcgatgccggg
tcgatcaaggtcagtggccgtggcgaacgcgagcccctggtcaaaacagccgatgaagtc
gccgagccgctcaatcggcgtgtcgagattcaggtgcgttga

DBGET integrated database retrieval system