KEGG   Dechloromonas aromatica: Daro_3604Help
Entry
Daro_3604         CDS       T00259                                 

Definition
(GenBank) hypothetical protein
Organism
dar  Dechloromonas aromatica
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ48333
UniProt: Q479Z8
Position
complement(3867329..3870154)
Genome map
AA seq 941 aa AA seqDB search
MAEPLKIIRRLNEVTTDYAVFERDQVLTETQLNSVVEYLDDQSRLTRTQLLGIGIVGGLW
PSLGKEQLVVSKGVGVTSDGDLIGLSDDTVFDRWLAYDESAPAYDAFYDGEKMLPLIELL
AADDKREGKPLAEIGDTLKQMVAIAFMESYENDPDLCTGGDCDNRGRTARNTQRLLLINR
ELAEKIRLNASFRTGAELARQLKRVRVTRVDLGTGSDAKVDVTSAELFAARYRTAADSSF
KALYGAVKQLIDRVGDGAALGLPSPVGWTAGLDKRLQALPGTVGGIQYFHDHAKDLVAVW
NDLRAALFADDGVLCPASEAFPKHLLLGALADPSVDRTGCYPAPWLAGGMLERQRVILLM
RKFGLLLDAFELPKAQIPKIIPSRRESIALDERAIPVYYRADATLRELWNDTRRQRGESE
DNTGYHWTQATDLQPILPEAPLAERQLPDPFLSDQGGNDFYRIEGFLGLKADVAERAIEK
LIRQRNLPISVVSALTHNQRQWIIRGPKFKKTSLHSLHYLLRQDLTSHLKDNIAYSGRLI
EDVKKAQTDWSADEDRKLKVGGIFTQHAALTTDYAKPIENAKIQLEAADTDLIGSATKPG
PLATRSYKGFVAQDKTIRERLSTVVVGAATAKANLGHVTRNDIVSPLDSFAGSKSHLWVD
WLGDILKKREDDQKDRLLLTNMLNEHPGLEHAGGVVPGGTFVLVYNDAGIVIGDLMLPYW
IDDNDESDFDEPQLTLPDISLRLPKDLMPIKFIKPLDLSFDDFKVTKIAPEIKIQENYSK
FFQTSLGSLGEVLKTKASSVNDGVKAATGDKYMEQMLAIVKSQQEQIKGLREVAGDDRMT
PATREKALEQAKAVEAQLAVSVGTTVEYFAVAAPETVRFEADKAAVYETVGSAINMVTDK
DASARLQTNLKETAIAANKVPTGSSAMVAEQMMNKVGIRIG
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaccgctcaagatcatccgccgcctcaacgaagtcaccaccgattacgccgtc
ttcgagcgcgatcaggtgctgaccgagacgcaactgaacagcgtcgttgaatacctcgac
gaccagagccgcctgacgcgcacgcaactgctcggcatcggcattgtcggtggcctgtgg
ccatcgctgggcaaggagcaactggtcgtcagcaagggcgtcggtgtgaccagcgatggc
gatctgatcggcctgtccgacgatacggttttcgaccgctggctggcctacgacgaaagc
gccccggcctacgacgccttctacgacggcgagaagatgctaccgctgatcgaactgctg
gctgccgatgacaagcgtgagggcaagccgctggccgagatcggcgatacgctgaagcag
atggtcgccatcgctttcatggaaagctacgaaaacgatcccgacctatgcaccggcggc
gattgcgacaaccgcggccgcacggcccggaacacccagcgcctgctgctgatcaatcgc
gaactggccgaaaagatccgcctgaacgccagcttccgcaccggcgccgaactggctcgc
cagttgaagcgtgtccgcgtgacgcgtgtcgatctcggtacgggtagcgacgccaaggtc
gatgtcacctcggccgaactgttcgccgcccgttatcgtacggccgccgatagcagtttc
aaggcgctgtacggggccgtaaagcaactgatcgaccgggtcggcgatggtgccgccctc
gggctgcccagcccggttggctggacggctggcctggacaagcgtctgcaggccttgccc
ggcacggtcggtggcatccagtattttcatgaccatgccaaggatctggtggcggtctgg
aacgacctgcgcgccgccctgttcgccgacgacggcgtgctttgcccggccagcgaggct
tttcccaagcacctgctgctcggggcgctggccgatccttcggtcgatcgcaccggctgc
tacccggcgccgtggctggctggcggcatgctcgagcggcagcgggtgatcctgctcatg
cgcaagtttgggttgctgctggacgccttcgagctgcccaaggcacagattcccaagatc
atccccagccggcgcgagagtatcgcgctcgacgaacgagccatcccggtctattaccgg
gcagatgccacgttacgcgaactgtggaacgacacccgccggcaacgcggcgagagcgag
gacaacaccggctaccactggacgcaggccactgacctacagcccatcctgcctgaagcg
ccgctggccgagcgccaactgcccgatcctttcctgagtgatcagggcggcaacgatttt
tatcgcatcgagggtttcctcggcctgaaggccgacgtggccgagcgggccattgaaaag
ctgatccgccagcgcaacctgccgatttcggtggtcagtgcgctgacgcacaatcagcgg
caatggatcatccgtggcccgaagttcaagaagaccagcttgcacagcctgcactacctg
ctgcgccaggacctgaccagccacctcaaggacaacatcgcctacagcggccgcctgatc
gaagatgtgaagaaggcgcagaccgactggagtgccgatgaggaccgcaagctcaaggtc
ggcggtattttcacgcagcacgctgcactgactaccgattacgccaagcccatcgagaac
gccaagatccagctcgaagcggccgataccgacctgatcggcagcgccaccaagccgggt
ccgttggccacccgcagctacaagggcttcgtggcgcaggacaagaccatccgcgaacga
ctgagcacggtcgtcgtcggcgccgccaccgccaaggccaacctaggccatgtgacgcgc
aacgacatcgtttcgccgctcgattcctttgccgggtcgaagagccacctttgggtggat
tggctcggcgacatcctgaaaaaacgcgaggacgatcagaaggaccgcctgctgctgacc
aacatgctgaacgagcatccgggactggagcatgccggcggcgtcgtgcccggcggcacg
ttcgtgctggtctacaacgacgccggtatcgtcatcggtgacctgatgctgccctactgg
atcgacgacaacgacgaaagcgatttcgacgagccgcaactgacgctgcccgacatcagc
ctgcgtctgccgaaggatctcatgccgatcaagttcatcaagccgctcgacctgagcttc
gacgacttcaaggtgaccaagatcgcacccgagatcaagattcaggaaaactacagcaag
ttcttccagacctcgctcggcagcctcggcgaggtgctgaaaaccaaggcatcatcggtc
aacgatggcgtcaaggccgcgaccggcgacaaatacatggaacagatgctggccatcgtc
aaatcgcagcaggagcagatcaagggcttgcgcgaagtggccggcgacgaccggatgacg
ccggcaacgcgcgagaaggcactcgaacaggccaaagcggtcgaggcgcaactggccgtt
tcggtcggcacgacggtcgaatactttgccgttgccgcaccggaaaccgtgcgcttcgaa
gccgacaaggcggcggtttacgagacggtcggttcggccatcaatatggtcaccgacaag
gatgccagcgctaggctgcagaccaacctcaaggaaacggccatcgccgctaacaaggtg
ccgaccggcagctcggccatggtcgccgagcagatgatgaacaaggtcggtatccgcatc
ggctga

DBGET integrated database retrieval system