KEGG   Dechloromonas aromatica: Daro_3637Help
Entry
Daro_3637         CDS       T00259                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
dar  Dechloromonas aromatica
Pathway
dar00630  Glyoxylate and dicarboxylate metabolism
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01120  Microbial metabolism in diverse environments
dar01130  Biosynthesis of antibiotics
dar01200  Carbon metabolism
Module
dar_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Daro_3637
Enzymes [BR:dar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Daro_3637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AAZ48366
UniProt: Q479W5
Position
3909856..3911235
Genome map
AA seq 459 aa AA seqDB search
MDQSNRYADLSLTEAELIAGGQHILCAYKMKPKAGHRYLEAAAHFAAESSTGTNVEVCTT
DEFTKGVDALVYHIDEASEDMRIAYPLDLFDRNMTDGRMMMASFLTLTIGNNQGMGDIEH
AKMVDFYVPRRGIELFDGPSKDISDLWRMLGRPVKDGGYIAGTIIKPKLGLRPEPFARAA
YEFWLGGDFIKNDEPQGNQVFAPLKKVIPLVYDSMKRAMDETGEAKLFSMNITADDHFEM
CARADFALEAFGPDADKLAFLVDGYVGGPGMITTARRQYPNQYLHYHRAGHGAVTSPSSK
RGYTAYVLAKMSRLQGASGIHVGTMGYGKMEGDKDDRACAYIIERDSYTGPVYHQEWYGM
KPTTPIISGGMNALRLPGFFENLGHGNVINTAGGGAYGHIDSPAAGARSLRQAYDCWKAG
ADPVEWARDHYEFARAFESFPQDADQLYPGWRHKLRPAA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggaccagtcaaaccgctatgccgatctcagcctgaccgaagccgaactgatcgccggt
ggccagcacatcctgtgcgcctacaagatgaaacccaaggccggccaccgctatcttgaa
gccgccgctcacttcgccgccgaatcatccaccggcaccaatgtcgaggtgtgtacgacc
gacgaattcacgaagggcgtcgatgccctggtctatcacatcgacgaggcgagcgaggac
atgcgcatcgcctacccgctcgacctgttcgaccgcaacatgaccgatggccggatgatg
atggcctccttcctgacgctgaccatcggcaacaaccagggcatgggcgacatcgagcat
gccaagatggtcgatttctacgtgccgcgccgtggcatcgagctgttcgacggcccgagc
aaggacatttccgacctctggcgcatgctcggccggccggtcaaggacggcggctacatc
gccggcaccatcatcaaacccaagctcggcctgcgcccggagcccttcgcccgcgccgcc
tacgaattctggctcggtggagatttcatcaagaacgacgagccgcagggcaaccaggtt
ttcgcgccgctaaaaaaggtcattccgctggtctatgattcaatgaagcgggccatggac
gaaaccggcgaggcaaagctgttctcgatgaacatcacggccgacgaccatttcgaaatg
tgtgcccgcgccgactttgccctcgaagccttcggcccggatgccgacaagctggccttt
ctggttgatggctatgtcggcggcccgggcatgatcactaccgcccgccggcagtaccct
aaccagtacctgcactaccaccgcgccggccacggcgccgtcacttcaccctcatcaaag
cgcggctacaccgcctacgtgctggccaagatgtcccgcctgcagggcgcttccggcatc
cacgttggcaccatgggctacggcaagatggaaggcgacaaggacgaccgcgcctgcgcc
tacatcatcgagcgcgacagctacacgggaccggtctatcaccaggagtggtacggcatg
aagccgacgacgccgatcatttccggcggcatgaacgcgctgcgcctgcctggcttcttc
gaaaatctcggtcacggcaatgtgatcaacacggcaggtggtggtgcgtatggtcacatt
gactcaccggccgccggtgcgcgctcgctgcgtcaggcttacgattgctggaaggccggg
gccgatccggtggagtgggcgcgcgaccactacgagttcgctcgggcgtttgaatcgttc
ccgcaggatgcggatcagttgtatccggggtggcggcataagttgcggccagcggcgtga

DBGET integrated database retrieval system