KEGG   Dechloromonas aromatica: Daro_3845Help
Entry
Daro_3845         CDS       T00259                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dar  Dechloromonas aromatica
Pathway
dar00230  Purine metabolism
dar01100  Metabolic pathways
Module
dar_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Daro_3845
Enzymes [BR:dar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Daro_3845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_22 MMR_HSR1 ABC_tran AAA_16 cobW RsgA_GTPase AAA_25 NTPase_1 MobB MLD Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: AAZ48573
UniProt: Q479A8
Position
complement(4137098..4137706)
Genome map
AA seq 202 aa AA seqDB search
MAGNLFVVAAPSGAGKTTLVRMLLEQESSVNLSISYTTRHPRPGEQNGREYHFVETPEFR
AMIARQEFLEWAEVHGNFYGTSKKWIADQLAAGRDVLLEIDWQGAQQVRALFPQAIGVFI
LPPSMEELTRRLTGRGTDSPDVIDRRLAAAQAEMRHVGEFDYVIINDQLAQALDDLRAVV
RASGLSFGAQRARHAALFERMI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaatctctttgtcgtcgcagccccgtcgggggccggcaagaccaccttggtc
cgcatgctgctggagcaggaatcgagcgttaatctttccatttcctacacgacgcggcat
ccgcgaccgggcgagcagaacgggcgcgaatatcacttcgtcgagaccccggagtttcgc
gccatgattgcccgccaggagtttcttgaatgggcagaggtgcatggcaatttctacggg
acatcgaagaaatggattgctgaccagctggctgccggtcgcgatgtgttgcttgaaatc
gactggcagggcgcccagcaggttcgcgccttgtttccgcaggcgatcggggttttcatc
ctgccgccctcgatggaggaattgacccgtcgtctgaccggtcgcggaaccgacagcccc
gatgtcatagaccgtcgccttgccgcagcgcaggcggaaatgcgccatgtcggggaattc
gactatgttattattaacgaccagctagcgcaggcgctggatgatttgcgtgcagttgtt
cgcgcatccggcctgagcttcggggcgcaacgtgcgcgtcacgccgccctgtttgaaaga
atgatctga

DBGET integrated database retrieval system