KEGG   Pseudodesulfovibrio aespoeensis: Daes_0189Help
Entry
Daes_0189         CDS       T01382                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
das  Pseudodesulfovibrio aespoeensis
Pathway
das00010  Glycolysis / Gluconeogenesis
das00030  Pentose phosphate pathway
das00051  Fructose and mannose metabolism
das00052  Galactose metabolism
das00230  Purine metabolism
das00500  Starch and sucrose metabolism
das00520  Amino sugar and nucleotide sugar metabolism
das00521  Streptomycin biosynthesis
das01100  Metabolic pathways
das01110  Biosynthesis of secondary metabolites
das01120  Microbial metabolism in diverse environments
das01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daes_0189
   00030 Pentose phosphate pathway
    Daes_0189
   00051 Fructose and mannose metabolism
    Daes_0189
   00052 Galactose metabolism
    Daes_0189
   00500 Starch and sucrose metabolism
    Daes_0189
   00520 Amino sugar and nucleotide sugar metabolism
    Daes_0189
  Nucleotide metabolism
   00230 Purine metabolism
    Daes_0189
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Daes_0189
Enzymes [BR:das01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Daes_0189
    5.4.2.8  phosphomannomutase
     Daes_0189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: ADU61216
UniProt: E6VV65
Position
complement(207993..209360)
Genome map
AA seq 455 aa AA seqDB search
MKTINRQIFRAYDIRGIVDQDFDAQWVREFGRACGAFFARRGATRALLGHDCRASSPAYQ
QAMAQGLTATGLDVVYLDQVSTPVFYFAARHLGFDAGVMITASHNPSEYNGFKVWSGRST
IHGQDVLDIHDLMVAGEYPVGAGLTSCHDILPTYRQDLLSRVTLARPLKVVVDGGNGAAG
DLTADILEAAGAEVIRLYCEPDGSFPNHHPDPVVEANMEDLKATVVAMGADFGVGLDGDG
DRIGAVDETGRLMYGDQLLAIYARDLLRDLPGAGVVADVKCSPLLFRDVEAHGGKAEMCV
TGHSIVKDRMIETGAAIGGEMSGHMFFFHGYHGFDDATFGALKLAGIVSRADRPLSAFLA
DWPTVYNTPEIRMDCAETIKFEVVARAQAYFKARYSVIDMDGARVEFGDGWGLVRASNTQ
GALVLRFEAESQARLDEIRQIMETPIRGWIKELGG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatcaacagacaaatattccgtgcctacgacatccggggcatcgtggaccag
gatttcgacgcccagtgggtgcgcgagtttggcagggcgtgcggtgccttctttgcccgg
cgcggcgccacccgcgccctgctcggccacgactgtcgggccagctcgcccgcctaccag
caggccatggcccaggggctgaccgccaccgggctcgacgtggtctatctcgaccaggtc
tccaccccggtcttttattttgcggcccgccacctgggctttgacgcgggcgtcatgatc
actgccagccataatcccagcgaatacaacgggttcaaggtctggagcgggcgctccacc
atccacggccaggacgtcctggacatccacgacctgatggtggccggggaataccccgtg
ggcgcgggcctgacctcctgccacgacattcttcccacctatcgccaggatctgctctcc
cgcgtcactctggcccggcctctcaaggtggtggtggacggcggcaacggcgcggcgggc
gacctgaccgccgacatcctcgaggctgccggggccgaggtgatccgcctctactgcgag
ccggacggctcctttcccaaccaccacccggacccggtggtggaggccaacatggaagac
ctcaaggccacggtggtggccatgggcgcggattttggcgtggggcttgacggcgacggc
gaccgcatcggggccgtggacgagacaggccgcctgatgtacggcgaccagctcctggcc
atctatgcccgcgatctgctgcgcgacttgcccggcgcgggcgtggtggccgatgtcaaa
tgcagccccctgctcttccgcgacgtggaggcccacggcggcaaggccgagatgtgcgtg
accggccactccatcgtcaaggaccggatgatcgagaccggcgcggccatcggcggcgag
atgtccggccacatgttcttcttccacggctaccacggctttgacgacgccacctttggc
gcgctcaagctggcgggcatcgtgagccgggccgaccgccccctgtccgccttcctggcc
gactggcccacggtctacaacaccccggaaatccgcatggactgcgcggaaaccatcaag
ttcgaggtggtggcccgcgcccaggcctacttcaaggcgcgctacagcgtcatcgacatg
gacggcgcgcgggtggaattcggcgacggctggggactggtccgcgcctccaacacccag
ggtgcgctggtgctgcgcttcgaggccgagtcccaggcccggctggacgagatcagacag
attatggagacccccatccggggctggatcaaggagcttggaggctga

DBGET integrated database retrieval system