KEGG   Pseudodesulfovibrio aespoeensis: Daes_1158Help
Entry
Daes_1158         CDS       T01382                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
das  Pseudodesulfovibrio aespoeensis
Pathway
das00620  Pyruvate metabolism
das00630  Glyoxylate and dicarboxylate metabolism
das01100  Metabolic pathways
das01110  Biosynthesis of secondary metabolites
das01120  Microbial metabolism in diverse environments
das01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Daes_1158
   00630 Glyoxylate and dicarboxylate metabolism
    Daes_1158
Enzymes [BR:das01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Daes_1158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ADU62173
UniProt: E6VTJ6
Position
1325259..1327418
Genome map
AA seq 719 aa AA seqDB search
MTKRIRVGGLAVSAPLHAMMETALVGTGLDARTFWGGLERIVADLGPRNRVLLEKRDTLQ
QAIDGWHRQRAGQPHDPAAYKKFLQEIGYLVPDGGDFAITTSGVDPEIATIAGPQLVVPV
TIARYALNAANARWGSLYDALYGSDVIDEGGGAHKGGVYNPVRGAEVFAFCARFLDTALP
LATGSHVQVTEYVLDAGGVQARLADGSLAALRTPGQFVGSADHDARLLFVNNGLHIELCI
DRAHPVGKDHPAGVRDVVLESALTTILDCEDSVAVVDGEDKALAYANMLGLALGTLEASF
PKGAKTVTRTMNPDRRYTGASGGEVVLPGRSLLLVRTVGHLMTTPAVLDAEGSEIPEGML
DAMATGLIFSHDLQGRGRVANSRAGAINIVKPKMHGPEEVAFACELFERTEQALGLPAGC
MKIGIMDEERRTTLNLRECIRQASDRVIFINTGFLDRTGDEIHTSMEAGPVVRKDAMKGQ
PWIMAYEDWNVDVGLACGFSGRAQIGKGMWAKPDRLGEMVATKGAHPAAGANCAWVPSPT
AATLHAMHYHETDVFARQGELMGQNRATRDQLLTLPLMARTPSVEEVEHELSNNCQSILG
YVVRWIDQGIGCSKVPDINDVGLMEDRATLRISSQHIANWLRHGVCSHDQVLTALKRMAA
VVDRQNADDPAYRPMAADFESSVAFQAASDLIFKGATQPNGYTEPILHARRLEAKAEYR
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacgaatccgggttggcggacttgccgtttccgcccctctgcacgcgatgatg
gagaccgccctggtcggcacgggcctggacgcccggaccttttggggcgggctggaacgc
atcgtggccgacctcggcccgaggaaccgcgtcctgctcgaaaagcgcgacacgctgcaa
caggccatcgacggctggcaccggcagcgggccgggcagccgcacgaccctgcggcatac
aagaaatttttgcaggagatcggctacctcgtgcctgacggcggcgattttgccatcacc
accagcggggtggacccggagatcgccaccatcgccgggccgcagctcgtggtgcctgtc
accatcgcccgctatgccctgaacgcggccaatgcccgttggggcagcctctacgacgcg
ctctacggcagcgacgtcattgacgagggtggtggcgcgcacaagggcggtgtctacaat
cccgtgcgcggggccgaggtctttgccttctgcgccaggtttttggatacggccctgccc
cttgccaccggctcccatgtgcaggtgacggaatatgttttggacgcgggcggcgtccag
gcccggctggccgacggcagcctggccgcgctgcgcacccccggccagttcgtcggcagc
gcggatcatgatgcccgtctgctttttgtcaacaacggcctgcacatcgagctgtgcatc
gaccgcgcgcatcccgtgggcaaggatcatcccgccggggtcagggacgtggtcctcgaa
tccgcgctgaccaccatccttgattgcgaggactcggtggccgtggtggacggcgaggac
aaggccctggcctacgccaacatgctcggactggcgctcggcacccttgaggcctcgttc
cccaagggcgcgaagaccgtcacccggaccatgaacccggaccgccgctacaccggggcc
agtggcggggaggtggtcctgccgggccgcagcctgctcctggtgcgcaccgtcgggcac
ctcatgaccacgcccgccgtgctcgacgccgaggggagcgagatccccgagggcatgctc
gacgccatggccacgggcctgattttctcgcacgacctgcaaggccggggcagggtcgcc
aacagccgcgccggggccatcaacatcgtcaagcccaagatgcatggcccggaggaggtc
gcctttgcctgcgaactctttgagcggaccgaacaggcgctgggcctgcccgccgggtgc
atgaagatcggcatcatggacgaggagaggcgcaccaccctgaaccttcgggaatgcatc
cgtcaggccagcgaccgcgtcatcttcatcaacaccggctttctcgacagaacgggcgat
gaaatccacaccagcatggaggccgggcccgtggtccgcaaggatgccatgaagggccag
ccctggatcatggcctatgaagactggaatgtggacgtggggcttgcctgcggtttcagc
ggccgggcccagatcggcaagggcatgtgggccaagcccgacaggctcggcgagatggtg
gccaccaagggcgcgcatcccgctgccggggccaactgcgcctgggttccctcacccacg
gcggccaccctgcacgccatgcattaccacgaaacggacgtgttcgcccgccagggcgag
ctcatgggccagaaccgcgccacgcgcgatcagctcctgactctgccgctcatggcccgc
acaccttccgtcgaggaggtggaacacgagctgtccaacaactgccaatccatcctgggc
tatgtggtgcgctggatcgaccagggcatcggctgctccaaggtgccggacatcaacgac
gtgggcctgatggaagaccgcgccaccctgcgcatctcaagccagcacatagccaactgg
ctgcgccacggcgtctgctcgcacgatcaggtgctcaccgcgctcaagcgcatggccgcc
gtggtggaccgtcagaacgcggacgacccggcctatcggcccatggccgcggacttcgaa
tccagcgtggccttccaagccgccagcgatctgatcttcaagggcgcaacacagccaaac
ggctacaccgaacccatcctccatgccagaaggctggaggccaaggccgaatatcgatag

DBGET integrated database retrieval system