KEGG   Pseudodesulfovibrio aespoeensis: Daes_1747Help
Entry
Daes_1747         CDS       T01382                                 

Definition
(GenBank) stationary-phase survival protein SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
das  Pseudodesulfovibrio aespoeensis
Pathway
das00230  Purine metabolism
das00240  Pyrimidine metabolism
das00760  Nicotinate and nicotinamide metabolism
das01100  Metabolic pathways
das01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:das00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Daes_1747
   00240 Pyrimidine metabolism
    Daes_1747
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Daes_1747
Enzymes [BR:das01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Daes_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: ADU62759
UniProt: E6VYJ6
Position
complement(1937656..1938417)
Genome map
AA seq 253 aa AA seqDB search
MKILLANDDGIQAVGLRALYFALVEAGHDVRVVAPVTEQSAVGHAVTLSMPLRVREFREN
GFRGQGVHGTPVDCVKLALSTLLDTPPDLVLSGINAGANVGVDILYSGTVSAATEGALME
IPSMAVSMDDFNPVDLSGQARYCARLLPRIPWDDLPPKCVMNLNFPACPIAEARELTVCP
HTSASYRDWYDARTDPRGRPYYWLDGAIPPERISPDCDRALLTKKHITLTPLHFDFTDRE
ALDVLARNFSASR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaagatacttctcgccaatgacgacggcatccaggccgtggggctgcgcgccctgtat
ttcgccctggtcgaggccgggcacgacgtgcgcgtggtcgccccggtcaccgagcagtct
gcggtgggacacgccgtgaccctgtccatgccgcttcgggtcagggagttccgcgagaac
ggctttcgggggcagggcgtccacggcacgcccgtggactgcgtcaagctggccctgtcc
accctgctcgacaccccgcccgatctggtcctctcgggcatcaacgcgggggccaacgtg
ggcgtggacatcctttattcgggcacggtctcggcagccaccgaaggcgcgctgatggag
attccctccatggccgtgtccatggacgacttcaatcccgtggacctttccggccaggcc
cgctactgcgcgcgactgctgcccaggattccctgggacgacctgccgcccaagtgcgtc
atgaacctcaatttccccgcctgtcccatcgcagaggcgcgcgagctgacggtctgcccg
cacaccagtgcatcctatcgcgactggtacgacgcccgcaccgacccgcgcggcaggccg
tactattggctcgacggggccatcccgcccgagcgcatcagcccggactgcgaccgggcg
ctgctgaccaaaaagcacatcaccctgacgccgcttcatttcgatttcacggaccgcgag
gcccttgacgtgctggcgaggaatttttccgcctcccgttga

DBGET integrated database retrieval system