KEGG   Desulfobacterium autotrophicum: HRM2_05050Help
Entry
HRM2_05050        CDS       T00861                                 

Gene name
folP
Definition
(GenBank) FolP
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00790  Folate biosynthesis
dat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HRM2_05050 (folP)
Enzymes [BR:dat01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HRM2_05050 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind BtpA DUF561 Bromodomain
Motif
Other DBs
NCBI-ProteinID: ACN13619
UniProt: C0QHR1
Position
complement(574976..575857)
Genome map
AA seq 293 aa AA seqDB search
MISAMAWKGFKLDLNDNPCIMGILNTTPDSFSDGGRYLKFDRAVDQGMALVEAGADIIDI
GGESSRPFATPVTVQEELDRVIPVIEALSTRIKVPISIDTVKARVAREAVQAGAAIINDI
SAMEHDPDMASVVFDAQVPVILMHMRGTPETMQIKPTYEDLMGEITTYLGNRIKVALDAG
IRQDRIILDPGIGFGKTLAHNLLLIRHIDRIKALGYPVLMGPSRKSFVQKILTQELGRTI
KADDPEAEQGTMAASIACLMNGADIVRVHDVKTFAPMARITGAILGHNRRQKC
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgattagtgccatggcgtggaagggatttaaacttgatcttaatgacaacccctgtatc
atgggtatcctcaataccacgcctgattcgttttccgacggtggccgctacctcaaattt
gacagggccgtggaccagggcatggccctggttgaggcaggggcagacattatagacatc
ggcggggaatcttcccgcccttttgctacacctgtgacggtccaggaagagttggaccgg
gtcattcccgtaatcgaagccctttcaaccagaattaaggtgcccatctccattgacacg
gtcaaggcccgggtggcacgggaggctgtccaggccggagcggccatcatcaacgacatt
tcagccatggaacacgaccctgacatggcgtctgtggtttttgacgcacaagtcccggtc
attctcatgcacatgcggggcacccctgaaaccatgcagatcaagcccacctatgaagat
cttatgggggaaatcaccacctatcttggtaacagaatcaaggttgcccttgacgccggc
atccgacaggacagaatcattcttgatccgggtatcgggtttggtaaaacacttgcccac
aaccttctgctcattcgacacatcgatagaatcaaggcccttggctatcccgtgctcatg
ggaccctccagaaaatcctttgttcaaaaaattctcacacaggaactgggcaggaccatc
aaagccgacgaccctgaggcggaacaggggaccatggcagcttccattgcctgcctcatg
aacggtgccgacatcgtccgggtgcatgatgtcaaaacctttgcgcccatggcccgaatc
actggggccatcctgggacacaaccgccggcaaaagtgttga

DBGET integrated database retrieval system