KEGG   Desulfobacterium autotrophicum: HRM2_07720Help
Entry
HRM2_07720        CDS       T00861                                 

Gene name
atoB1
Definition
(GenBank) AtoB1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00071  Fatty acid degradation
dat00072  Synthesis and degradation of ketone bodies
dat00280  Valine, leucine and isoleucine degradation
dat00310  Lysine degradation
dat00362  Benzoate degradation
dat00380  Tryptophan metabolism
dat00620  Pyruvate metabolism
dat00630  Glyoxylate and dicarboxylate metabolism
dat00640  Propanoate metabolism
dat00650  Butanoate metabolism
dat00900  Terpenoid backbone biosynthesis
dat01100  Metabolic pathways
dat01110  Biosynthesis of secondary metabolites
dat01120  Microbial metabolism in diverse environments
dat01130  Biosynthesis of antibiotics
dat01200  Carbon metabolism
dat01212  Fatty acid metabolism
dat02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HRM2_07720 (atoB1)
   00630 Glyoxylate and dicarboxylate metabolism
    HRM2_07720 (atoB1)
   00640 Propanoate metabolism
    HRM2_07720 (atoB1)
   00650 Butanoate metabolism
    HRM2_07720 (atoB1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HRM2_07720 (atoB1)
   00072 Synthesis and degradation of ketone bodies
    HRM2_07720 (atoB1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HRM2_07720 (atoB1)
   00310 Lysine degradation
    HRM2_07720 (atoB1)
   00380 Tryptophan metabolism
    HRM2_07720 (atoB1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HRM2_07720 (atoB1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HRM2_07720 (atoB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HRM2_07720 (atoB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dat04147]
    HRM2_07720 (atoB1)
Enzymes [BR:dat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HRM2_07720 (atoB1)
Exosome [BR:dat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HRM2_07720 (atoB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACN13886
UniProt: C0QJN3
Position
complement(874060..875310)
Genome map
AA seq 416 aa AA seqDB search
MKEVVIVSGCRTAIGGFGGTLKNLSGAYLASITMKEAIKRAGIDPAIIDDVRYGTCIESF
DTLNTARVAALLAGIPETITAVTVNRVCISGMEAMISGMAMIQAGMADVILAGGTEHMSS
APYAAPGARWGCRLQDQTLVDTLIHALHCGSHVIPHPEDGPVDETKAPLSMFVGKPYIMG
HTAEFIAQHLGITREESDQIALRSHNSAERATSDGSFAEEIVPVPVPQRKKDPILFDKDE
HFRPGMTMEKLAKLPPAFVPKIGTVTAGNASGLNDGATGMIIMSLDRAKELGLKPIARIK
AVSRGACHPSVMGLSPVPAVKNLIKNSNLSLEDFELMEVNEAFAAQYLGCEKELGLNREI
TNVNGSGIGLGHPVGSTGARIVVTLMHALKHRNKTLGMATLCGGGGVSMACAIEMI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagttgtaatcgtttcaggatgcaggaccgccattggcggctttggtgggaca
ctaaagaatttgagtggggcataccttgcctcaatcaccatgaaagaagcgatcaaacgg
gccgggattgatccggcaatcatcgacgatgtgcggtacggcacctgcattgaatccttc
gacacccttaacacggcaagggtggcagcccttctggccggtattccagaaaccataaca
gccgtcacggtcaaccgggtatgcatctcgggcatggaagccatgatttcaggcatggcc
atgatccaggccggcatggctgatgtcatccttgccggcggcaccgaacatatgtcaagc
gccccctatgccgctccaggagcaagatggggatgccgcctccaggatcagaccctggtg
gacaccctgatccacgccctccactgcggatcccatgtgattccccatcccgaagacgga
ccggttgacgaaacaaaggcgcccttgagcatgtttgtgggcaagccctatatcatgggc
cacacggccgagttcattgcccaacatctgggtatcacccgggaagagtccgaccagatc
gccctgagaagccacaattcagccgaacgcgccaccagcgacggctcgtttgccgaagaa
atcgtgccggttcccgttccccagcgaaaaaaagatcccattctctttgacaaggacgaa
catttcaggcccggcatgaccatggaaaaacttgccaagctgcccccggcctttgtgccc
aagatcggtacagtcacggcaggcaacgcctcgggactcaacgacggggcaaccggcatg
atcatcatgtcccttgaccgggcaaaggaactgggtctcaaacccattgccaggatcaag
gcggtttcaaggggagcctgtcacccctcggtcatgggcctctctcctgttcctgcggtc
aaaaatctgatcaaaaacagcaacctttcgttagaagactttgagctcatggaagtcaat
gaagcctttgcggcccagtaccttggttgcgaaaaagaacttggcctcaaccgggagatc
accaatgtcaatggatctggtatcggccttggccaccccgtgggttccacgggtgcaaga
atcgttgtcaccctcatgcatgccttgaaacacagaaacaagacccttggcatggcaacc
ctgtgcggcggcggcggtgtgtccatggcctgcgccattgaaatgatctaa

DBGET integrated database retrieval system