KEGG   Desulfobacterium autotrophicum: HRM2_10890Help
Entry
HRM2_10890        CDS       T00861                                 

Gene name
cysG
Definition
(GenBank) CysG
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00860  Porphyrin and chlorophyll metabolism
dat01100  Metabolic pathways
dat01110  Biosynthesis of secondary metabolites
dat01120  Microbial metabolism in diverse environments
Module
dat_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HRM2_10890 (cysG)
Enzymes [BR:dat01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     HRM2_10890 (cysG)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     HRM2_10890 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Pyr_redox CysG_dimeriser Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ACN14201
UniProt: C0QLB5
Position
complement(1238440..1239105)
Genome map
AA seq 221 aa AA seqDB search
MKYYPVGLNIQDRNCLVVGGGRVGARKAETLARCRARVKVVSPCFDETLWNHLVSTVELV
KREYLPQDLKGMFLVVGATDNRQLNKTIGKQARQAGILFNGADLPELSDFIVPAVVKRGD
LTIAVSTSGNSPAFAKKIKHQLEGRFGPEYERFLSLMGKIRQNLLAREHAPGSHKKIFKQ
LIDSQLLDRMRENDQEAIERLVVDILGNRHGVETLFQEKNK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattacccagtgggcctgaacattcaagatcgaaactgccttgttgtgggcggt
ggcagggtgggggccagaaaggcagaaacccttgcccgttgccgggccagggtcaaggtg
gtgagtccctgttttgatgaaaccctctggaaccacctggtttccacggttgaacttgtc
aaaagggagtaccttcctcaggatctcaagggaatgtttctcgtggtcggcgcaaccgac
aacaggcaactcaacaagaccatcggcaagcaggccagacaggcggggattcttttcaac
ggggcagacctgccggaactgagcgatttcattgtgccagccgttgtgaaaagaggagat
ctcaccattgccgtgtccacttcgggcaatagtccggcctttgcaaaaaaaatcaaacac
cagcttgaaggccggtttggccctgaatatgaacgatttctctccctgatgggcaaaatc
aggcagaacctccttgcccgggaacacgccccgggcagccacaaaaagatattcaaacag
ctgattgacagccaactgctcgatcgcatgagggaaaatgaccaggaggcaatcgagcgt
ttggtcgtggatatccttggcaaccgacacggggttgaaactcttttccaggaaaaaaac
aaatga

DBGET integrated database retrieval system