KEGG   Desulfobacterium autotrophicum: HRM2_16730Help
Entry
HRM2_16730        CDS       T00861                                 

Gene name
metF1
Definition
(GenBank) MetF1
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00670  One carbon pool by folate
dat01100  Metabolic pathways
dat01120  Microbial metabolism in diverse environments
dat01200  Carbon metabolism
Module
dat_M00377  Reductive acetyl-CoA pathway (Wood-Ljungdahl pathway)
Brite
KEGG Orthology (KO) [BR:dat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    HRM2_16730 (metF1)
Enzymes [BR:dat01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     HRM2_16730 (metF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ACN14781
UniProt: C0QAY2
Position
1919587..1920468
Genome map
AA seq 293 aa AA seqDB search
MRVGNLYKNQSDPSVSFEFFPPRDDKAESSFYGVVDALSALNPAYMSMTFGAGGSTSEGS
FQAVKRMMIEKNLPMVAYIAGYGLGPHEITEVLDRYKALGVETIFVIRGDKPRTDGFTPH
PESFAHASDLIRFISDRYDFDLGCAGYPEGHVQAESLEKDVEYLRLKQDNGAQYVVAQYF
YDNDSFYRYVDLCRKSGITIPIIPGIMPIYTVKLTRMLCKLCGSTLPTGLREKLDSLTND
KSEAVADLGVNFAFDQCRDLVLKGVDGLHFYTMDRSGSVLKIVQRLKDDGLFK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagagttggaaatctttataaaaatcagtccgatcccagtgtctcctttgagtttttt
cctcccagggacgataaggctgaatcttctttttatggggttgttgatgcgctttccgct
ttaaatcctgcctacatgtcaatgacctttggggcaggcgggtcaaccagcgaggggtcc
ttccaggcggttaaacgtatgatgattgaaaagaacctgcccatggttgcctatatcgca
ggttatggtcttggaccccacgagatcaccgaggtgcttgaccggtataaagcactgggg
gttgagaccatctttgtgatccggggagacaaaccaagaacagatggctttacaccccat
ccggaaagtttcgcccatgcttcagatctgatccggtttataagcgatcgttatgatttt
gaccttgggtgtgcaggctaccctgaaggccatgtccaggccgaaagccttgaaaaggat
gttgaatatctcaggttgaagcaggacaatggtgctcaatacgtggttgcccagtatttt
tatgacaatgatagtttctatcgctatgttgacctttgcaggaaatctggtataaccatt
cccattatcccaggcatcatgcccatatacacggtcaaactgacccgtatgctgtgtaag
ctttgcggttcgacccttccgaccggtttaagggaaaagcttgattcactgaccaatgac
aagtcagaagccgtggcagaccttggtgttaattttgcctttgatcagtgcagggatctt
gtgttaaaaggggtagacgggttgcatttttataccatggatcgatccgggtctgtcctt
aagattgttcaacggcttaaggatgatggattgttcaagtaa

DBGET integrated database retrieval system