KEGG   Desulfobacterium autotrophicum: HRM2_31420Help
Entry
HRM2_31420        CDS       T00861                                 

Gene name
gatB
Definition
(GenBank) GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00970  Aminoacyl-tRNA biosynthesis
dat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dat00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HRM2_31420 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dat03029]
    HRM2_31420 (gatB)
Enzymes [BR:dat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HRM2_31420 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HRM2_31420 (gatB)
Mitochondrial biogenesis [BR:dat03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HRM2_31420 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: ACN16225
UniProt: C0QKY5
Position
3556873..3558303
Genome map
AA seq 476 aa AA seqDB search
MQFEPVIGLEVHAQLDTETKIFCSCSTGFGASPNAHTCPVCTGMPGVLPVLNKKAVTYAI
RTGLATNCKVANESRFDRKNYFYPDLPKGYQITQFAAPIAEHGHLTIELDDGSEKRIGIT
RIHMEEDAGKLIHDPDRPRSMVDLNRTGIPLVEIVSEPDLRTPKEAGSYLRKLHAIVRYI
GVCNGNMEEGSFRCDANISLRPVGRKAFGTRTELKNLNSFRNVEKAIAYEIQRQTYVLEE
GGEVIQETRLWDTANNKTVSMRSKEEAHDYRYFPEPDLVPLIVDDRWMEEVRQSLPELPD
AKRQRFMDDYAMTAYDASVLTSSIALADFFEQTAKEINEPKLAANWIMGPVLALLKDQET
TITSLPITADALAELLKLIEAGKINANAAKTIFDRMVTTSEGPGKIVEEMGLEQVSDQGE
LETIVAEVLKANPDEVESYLGGKTKLMGFFMGQIMKKSRGKADPKIVTQILKQRLK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttgaacctgtaatcgggcttgaagtccatgcccagcttgacactgagacaaaa
atattctgctcctgctccacgggtttcggcgcgtctcccaacgcccacacctgtcccgta
tgcacgggaatgccgggggtgcttccggttcttaacaaaaaggccgtcacctatgccata
cgaacgggccttgccaccaactgcaaggtggcaaacgagagccggtttgaccggaaaaac
tacttttaccccgatctgccaaaggggtatcaaatcacccagtttgcagcccccattgct
gagcacggccacctgaccattgaacttgacgacggatcggaaaaacgcatcggcatcacc
cgcatccacatggaagaggatgcaggtaaactgatccacgaccctgaccgccccaggagc
atggtggatctcaaccgaacgggaattcccctggttgagatcgtgagcgagcctgacctg
aggacccccaaggaggccggcagctatttgagaaaactccacgccatagtcaggtacatc
ggggtttgcaacgggaacatggaagagggaagctttcggtgtgacgccaacatctccctg
cggccggtgggccgtaaggcctttggcacacggactgagctgaagaaccttaattcattc
cggaacgttgaaaaggccattgcctatgaaatccagcgccagacctatgtattagaagag
ggcggagaggtgatccaggagacacgcctctgggatacggccaacaataaaaccgtgtcc
atgcgcagcaaggaagaggcccacgactaccgctattttccggaacctgaccttgtcccc
ctcatcgttgacgaccgctggatggaggaggtcaggcaaagccttcctgagcttcccgat
gcaaagcgccagcggttcatggacgactatgcaatgaccgcctatgatgcatcggtactc
acatcctcaatcgcccttgccgacttttttgaacaaacggccaaggagatcaacgagcca
aagcttgccgccaactggatcatgggcccggtgcttgccctgctaaaggaccaggagacg
accattacctccctgcccatcaccgccgacgcccttgccgaacttttaaaactgattgaa
gccggtaagataaatgccaatgctgcaaaaaccatatttgaccgcatggtgacaaccagc
gaggggcccggaaagatcgtggaggagatgggactggaacaggtgtctgaccagggtgaa
cttgaaaccatcgttgcagaggtgttaaaggccaaccccgatgaagtcgaatcctatctg
ggcggaaagaccaaactcatgggctttttcatgggccagatcatgaaaaagagccggggt
aaagccgaccccaagatcgtcacccagatccttaaacaaaggctcaaataa

DBGET integrated database retrieval system