KEGG   Desulfobacterium autotrophicum: HRM2_31800Help
Entry
HRM2_31800        CDS       T00861                                 

Gene name
pcb
Definition
(GenBank) Pcb
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00020  Citrate cycle (TCA cycle)
dat00620  Pyruvate metabolism
dat01100  Metabolic pathways
dat01120  Microbial metabolism in diverse environments
dat01200  Carbon metabolism
dat01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HRM2_31800 (pcb)
   00620 Pyruvate metabolism
    HRM2_31800 (pcb)
Enzymes [BR:dat01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     HRM2_31800 (pcb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 GCV_H TGT
Motif
Other DBs
NCBI-ProteinID: ACN16261
UniProt: C0QLF7
Position
complement(3594572..3596623)
Genome map
AA seq 683 aa AA seqDB search
MSEHGRIHMCEINCEKERPKAKNPLKIMDLSLRDGHQSLFATRGRTEDMIPVAERMDAVG
FWAVEVWGGATFDSMHRFLNEDPWERIRTLKRYFKKTPFSMLLRGQNLVGYRNYADDVAK
AFVNRACENGMDVFRTFDALNDYRNFEAVVPVIKSCGKHFQGSICYSLTEPRMGGTVYTL
EYYVNKAKELVDLGADSICIKDMAGLMAPYDAFDLVKALKESVDIPINLHSHFTSGMAPM
THLKAVEAGVDILDTCLTPYAYRTSHPALEPMVMSLIGTDRDTGFDIETLASINETLEKE
ILPKYRHLLDDTKVSVIDINVLLHQTPGGMLSNLVNQLRDMDALDRLSEVFEQLPRVRKE
LGQIPLVTPTSQIVGTQTVNNVLFDTPEDRYKMITAQVKDLCYGLYGKTAVPIDPEVQKK
ALKGYERGEEPITCRPAEVLKPELDAARAEIKDLAVDEDDLILYTLFPVTGKKFLQRKYG
KETVPESMKAITLEDVKRQAEIVRKAKAGELVERNSDRDLPEKTDCLRTFNVFVEDECFE
VGVDEVGGAPVIAYAQPAQVQSQAAAPAPAQQGTRVPPPPARAAAAAPAPRAAAPAPRAE
KPAPAAAPAKGGSGVGVKAPMPGMIIKYEKGVGDAVKKGDTVVVLEAMKMENALPSPVDG
VITALKFGSGDSVSKGDLLAVIE
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacacggcagaatacacatgtgtgagattaattgtgaaaaagagaggcccaag
gctaaaaatccccttaaaattatggacctctccctgagggatggtcaccagtctctgttt
gccacaaggggaagaaccgaggatatgattcccgtggcagaacgcatggatgcggttggc
ttctgggccgttgaggtctgggggggtgcaacctttgacagcatgcatcgtttcttgaac
gaagatccctgggagcggatcaggaccctcaaacgctattttaagaagacccccttttcc
atgctgctcagggggcagaaccttgtcgggtatcgcaactatgccgacgatgttgcaaag
gcctttgtcaaccgggcctgtgagaacggaatggacgtattcaggacctttgatgccctg
aacgattaccgtaactttgaggctgtggttcccgtgatcaagagctgcggcaagcacttt
cagggaagcatctgctactccctgaccgagccccgaatgggcggtacggtctacaccctg
gagtactatgtgaacaaggcaaaagaacttgtggacttgggcgcagacagtatctgcatc
aaggacatggccggtctcatggctccctacgatgcctttgaccttgtcaaggcccttaag
gaaagcgtggatatccccatcaaccttcattcccacttcacctcgggcatggcacccatg
acccatctcaaggcggttgaggcaggggttgatatccttgatacctgtctgaccccctac
gcctaccgaaccagccatcccgcccttgagcccatggttatgtcgctgatcggcacggac
agggataccggttttgacattgagaccctggcgtcgatcaatgaaaccctggaaaaggag
attctgcccaagtaccgccaccttctggatgacaccaaggtgtcggtcatcgacatcaac
gtgctgttgcaccagaccccgggtggaatgctttccaatctggtcaatcagctcagggac
atggatgcccttgatcgactttccgaggtgtttgaacagcttcccagggtgagaaaggaa
cttggccagattccccttgttacccccacaagtcagatcgtcggcacccagaccgtgaac
aacgtgctgtttgacaccccggaggatcgctacaagatgataacggcccaggtcaaggat
ctatgctatggcctctacggaaaaacggccgtgcccattgatcctgaggttcagaaaaag
gccctcaaggggtatgaacggggtgaggaacccatcacctgcaggcccgccgaggtgttg
aaacccgagcttgacgctgccagggccgagatcaaggatcttgccgtggatgaggatgac
ctgatcctctataccctgtttccggttaccggcaaaaagtttctccagcgtaaatatgga
aaagagactgttcctgagagcatgaaggccattaccctggaggatgtgaaacggcaggcg
gagattgttcgaaaggcaaaggccggagaacttgtggagcgcaattcggaccgagacctt
ccggaaaagaccgactgcctgagaacctttaacgtgtttgtggaggatgaatgctttgag
gtcggggttgacgaggtcggtggcgcaccggtcattgcctatgcccagccggcccaggtt
cagtcccaggcggcagcaccagcacccgcccagcagggaacaagggtgcctccaccacct
gcccgtgcagctgcagcagcaccggcacccagggcggcagcaccggcacccagggctgaa
aagccagcacctgctgcggctcctgcaaagggcggctcaggtgtgggagtcaaggccccc
atgcccggcatgatcatcaagtatgaaaagggcgtgggcgatgcagtcaaaaaaggggac
accgttgtggtcctcgaagccatgaagatggagaacgccctcccgtctccggtggatggt
gtgataacggccctgaaattcgggtcaggtgattccgtatccaagggagacctgcttgcc
gtcatagaataa

DBGET integrated database retrieval system