KEGG   Desulfobacterium autotrophicum: HRM2_32450Help
Entry
HRM2_32450        CDS       T00861                                 

Gene name
sucC1
Definition
(GenBank) SucC1
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00020  Citrate cycle (TCA cycle)
dat00640  Propanoate metabolism
dat00660  C5-Branched dibasic acid metabolism
dat01100  Metabolic pathways
dat01110  Biosynthesis of secondary metabolites
dat01120  Microbial metabolism in diverse environments
dat01130  Biosynthesis of antibiotics
dat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HRM2_32450 (sucC1)
   00640 Propanoate metabolism
    HRM2_32450 (sucC1)
   00660 C5-Branched dibasic acid metabolism
    HRM2_32450 (sucC1)
Enzymes [BR:dat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HRM2_32450 (sucC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A PSI_PsaE
Motif
Other DBs
NCBI-ProteinID: ACN16324
UniProt: C0QLM0
Position
complement(3677349..3678506)
Genome map
AA seq 385 aa AA seqDB search
MKIHEYQAKALFRTFGVPVPDGGVAFSVEEAVDVARGLGGYPVVVKAQIHAGGRGKGGGV
KLAASEEEARRFAGEILGMTLVTHQTGPQGREVKKLLVEAGQKIAKELYLSILVDRATAG
IVIMASQEGGMDIETVAAKTPEKIIKVRVDPLTGIQGYYLRQVGFGLGLPKAALKEFSAL
LKNLYTLFVKNDCSLLEINPLILTSDDRVMALDAKVDIDSNALFRHKDLVELRDLDEEDP
LEVEASKFNLNYINLDGNVGNIVNGAGLAMATMDIIKNAGAEPANFMDVGGGATAEMVEN
AFSIILRDKKVKAVLINIFGGILRCDVFAEGIVTAAKKSGITIPVVVRMEGTNVERGKEI
LAQSGLNLINAVNLKDAAEKVAAAI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacatgaataccaggcaaaggcgttgtttcgaacctttggtgttccggttccg
gacgggggggtggccttttccgttgaagaggccgtggatgttgccaggggccttggcggc
tatcctgtggtggtcaaggcccagatccatgccgggggccggggaaagggcgggggtgtt
aaacttgccgcatccgaggaagaggcaaggcgttttgccggtgaaatccttggtatgacc
cttgttacccaccagaccggtccccagggccgtgaggtgaaaaaattgctggtcgaagcc
ggccagaagattgcaaaggaactctacctgagcattcttgtggaccgtgccacggcaggt
attgtgatcatggcaagccaggaaggcggcatggatatcgaaactgtcgccgccaaaacc
cctgaaaagattatcaaggtgagggttgatcccctcaccggaatccaggggtattatctc
cgccaggtgggatttggtcttgggcttcccaaggcggcactcaaggaattttcagccctg
ttgaaaaatctttacaccctgtttgttaaaaacgactgttcactcctggagatcaatcca
ctgatccttacctcggacgacagggtcatggccctggatgccaaggtggacattgattcc
aatgccctgttccgccataaggatctggttgaactgagggatcttgacgaggaagatccc
ctggaagttgaggcctcaaagttcaatctcaactacatcaaccttgacggtaacgtgggc
aacatcgttaacggtgccggtcttgccatggccaccatggacatcatcaagaacgcaggg
gctgaacctgccaacttcatggatgtggggggcggcgccacggctgaaatggtggaaaat
gcattcagcatcattctccgggacaaaaaggtgaaggcggttctcatcaatatttttggc
gggattctgcgctgcgacgtttttgccgagggcattgtcactgcggcaaaaaagagcggc
attaccattccggtggttgttcgcatggaggggaccaatgtggaacggggcaaggagatt
cttgcccagtccgggctcaacctgatcaatgccgtaaacttgaaggacgcagccgaaaag
gttgcagccgccatataa

DBGET integrated database retrieval system