KEGG   Desulfobacterium autotrophicum: HRM2_33440Help
Entry
HRM2_33440        CDS       T00861                                 

Gene name
trpB
Definition
(GenBank) TrpB
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00260  Glycine, serine and threonine metabolism
dat00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dat01100  Metabolic pathways
dat01110  Biosynthesis of secondary metabolites
dat01130  Biosynthesis of antibiotics
dat01230  Biosynthesis of amino acids
Module
dat_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HRM2_33440 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HRM2_33440 (trpB)
Enzymes [BR:dat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HRM2_33440 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACN16419
UniProt: C0QMA2
Position
complement(3792029..3793255)
Genome map
AA seq 408 aa AA seqDB search
MINRGYYGTFGGAFVPEILVATFDELEREFRKIKADPAFWNEYRDLMGSYSCRPTPLTYA
ENLTKHFKGAKIYIKREDLNHTGAHKANNVMGQGLLVKRMGKTRVIAETGAGQHGVATAT
MAAKFGFDCTVYMGEVDVKRQRPNVFWMEQMGATVVPVTQGSRILKDAINEAFRDWVTNM
DTTHYVLGTACGPHPFPEMVSWFQSIIGKEARRQILEREERLPTRVYACVGGGSNAMGLF
AGFTDGDVECVGVEAAGRGIASGQHASRLCSNDASVGVAQGYKTYFLQNSDGQMNETHSI
AAGLDYVGVSPILASMHEKGEARFEAVTDTEVIEALKLTMKSEGIIPALESAHAFAQAFK
EAPAMSTNDIIIINQSGRGDKDIFTIADAIGDPSWRKFIMEKAGEYNA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgattaacaggggatattacggaacctttggcggagcttttgtacctgagattctggtt
gcaacctttgatgaactggaacgagagttcagaaaaataaaggctgatccagccttctgg
aacgagtaccgtgacctcatgggttcctactcgtgccggcccaccccgctgacctatgct
gaaaatctcacaaagcattttaaaggtgcaaaaatttacatcaagcgtgaggacctcaac
cataccggtgcccacaaggccaacaatgtcatgggccaggggcttctggtcaaacgcatg
ggcaagacccgggtgattgcggagaccggggcgggccagcacggggtggcaacggccacc
atggccgcgaagttcgggtttgactgcacggtgtacatgggggaggtggatgtcaaacgc
cagcgacccaatgtcttttggatggaacagatgggggccacggttgtgcccgtgacccag
ggctcacggattttaaaggatgccatcaacgaggcgttccgggactgggtgacgaatatg
gataccacccattacgtgctcggaacggcctgcggaccccatccctttcccgaaatggtc
agctggttccagtccatcattggaaaagaggcaagacggcaaattctggaacgggaagaa
cggcttcccacccgggtctatgcctgtgtggggggggggtcaaatgccatggggctcttt
gccggattcactgatggggatgttgaatgtgtcggggtggaggcggcaggacgcgggatc
gcctctggacagcatgcttcaaggctgtgcagcaatgatgcaagcgtcggcgttgcccag
gggtacaagacctattttctccagaacagtgacggccagatgaacgaaacccactccatt
gcggccggccttgactatgtgggggtttctccgattcttgccagcatgcacgaaaaagga
gaggcaaggtttgaggctgtgaccgacacagaggtgatcgaagcgttaaagctcaccatg
aaaagtgaaggtatcatcccggccctggagtcggcccacgcctttgcccaggcattcaag
gaggcgccggccatgtcaacgaacgatatcattatcatcaaccagtcgggtaggggagac
aaggatatttttaccattgccgacgctattggtgatccatcctggagaaaatttatcatg
gaaaaggcaggtgaatacaatgcttga

DBGET integrated database retrieval system